KEGG   Bacillus subtilis subsp. subtilis 168: BSU05780
Entry
BSU05780          CDS       T00010                                 

Symbol
ydhJ
Name
(RefSeq) hypothetical protein
  KO
K06885  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU05780 (ydhJ)
SSDB
Motif
Pfam: HD HD_4
Other DBs
NCBI-GeneID: 938014
NCBI-ProteinID: NP_388459
Pasteur: BG12187
BSORF: BG12187
UniProt: O05502 A0A6M4JFU9
Position
623373..624350
AA seq 325 aa
MEISDIIYGQHHIDGVLEELIKSAPVQRLKGIYQGGASFLVNRKWNVTRYEHSIGVMLLI
KKLGGTIEEQIAGLLHDVSHTAFSHVVDVVFENQAEDYHENIFQQVIVHSEIPDILQKHG
YHTEELLSDDSRWTLLEQPAPELCADRTDYTLRDMYRYGHINLHEAQTFLDHLIVRNGRM
FPDSIEAAEWFVSVYYKEVIDFFLNPVNVYGYEYLARALKAALRHDVISAEDLLKTDQEV
LNILRASKNEEVLSLLTSIHPGIQVIEDDIQYDFHQKKKMRLIDPSIFLDDKWIKSSGVS
EKVRKMGEAAYQKAKKGVYIKILKQ
NT seq 978 nt   +upstreamnt  +downstreamnt
atggaaatcagcgatatcatttacgggcagcaccatatagacggagtgctggaagagctt
atcaaaagcgctcctgtgcaaagattaaaaggaatctatcaaggcggagcaagcttttta
gtcaatcgaaagtggaatgtgaccaggtatgagcactccatcggcgtgatgctcctcatc
aaaaagctcggaggaacgatagaagaacagattgcgggtctgctccacgacgtatcacac
acagctttttctcatgtggtcgacgttgtctttgaaaatcaagcagaagactatcatgaa
aacatctttcaacaagtcattgttcactctgaaatcccggacattttacaaaaacacggc
tatcatactgaagaacttttatctgacgattcaaggtggacattgctcgaacagcccgca
ccggagctgtgtgctgatcggacagactatacgctgcgtgatatgtaccgatatggacac
attaacctgcacgaagcgcaaacctttttggatcatcttattgtgagaaacggaaggatg
tttcctgatagtattgaagccgccgaatggtttgtcagtgtgtactacaaggaagtaatt
gatttctttttgaatcctgtgaatgtatatggatatgaatatttagcgcgagcattgaag
gcagcgctgcggcatgatgtcatatctgcagaggatctgctgaaaacggaccaagaggta
ctgaacatcctgcgtgcatcaaaaaatgaagaagtcctgagcttgcttacatccattcat
cccggcatacaagtaatagaggatgacatccagtacgatttccatcaaaagaagaaaatg
cgcctaatcgatccatccatttttcttgatgacaaatggatcaaatcctcaggtgtttct
gaaaaggtgaggaaaatgggtgaggccgcttatcaaaaagcaaaaaaaggtgtgtatata
aaaatcttaaagcagtaa

DBGET integrated database retrieval system