KEGG   Bacillus subtilis subsp. subtilis 168: BSU05790
Entry
BSU05790          CDS       T00010                                 

Symbol
ydhK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1541 LPAM_2
Other DBs
NCBI-GeneID: 939873
NCBI-ProteinID: NP_388460
Pasteur: BG12188
BSORF: BG12188
UniProt: O05503 A0A6M4JFL9
Structure
Position
624492..625109
AA seq 205 aa
MSAGKSYRKKMKQRRMNMKISKYALGILMLSLVFVLSACGNNNSTKESTHDNHSDSSTHE
EMDHSGSADVPEGLQESKNPKYKVGSQVIINTSHMKGMKGAEATVTGAYDTTAYVVSYTP
TNGGQRVDHHKWVIQEEIKDAGDKTLQPGDQVILEASHMKGMKGATAEIDSAEKTTVYMV
DYTSTTSGEKVKNHKWVTEDELSAK
NT seq 618 nt   +upstreamnt  +downstreamnt
ttgtctgcgggcaaaagttacaggaaaaaaatgaagcaaaggagaatgaacatgaaaatc
tctaaatatgcactgggaattctgatgttatctctagtttttgttttatcagcatgcggc
aataacaacagtacgaaagaaagcacacatgacaatcattcagactcctcaacacatgaa
gagatggaccattccggatcagctgacgttccagagggattacaggaatctaaaaatccg
aaatacaaagtaggcagccaagtaatcatcaatacttctcatatgaaaggcatgaaaggt
gctgaagctacggtaacaggcgcctatgatacaacggcgtatgttgtttcttatactccg
actaatgggggacagcgtgtggatcatcacaaatgggtgatccaagaagaaatcaaagat
gccggagataaaacgttacaacccggagatcaggtgattttagaggcttctcatatgaaa
ggcatgaaaggagcaacagccgagatcgattccgcggaaaaaacaactgtatacatggtt
gactacacatcgacaacgagcggcgaaaaagtgaaaaaccacaaatgggtcacagaagat
gagctttcagctaaataa

DBGET integrated database retrieval system