KEGG   Bacillus subtilis subsp. subtilis 168: BSU05800
Entry
BSU05800          CDS       T00010                                 

Gene name
pbuE
Definition
(RefSeq) purine efflux pump PbuE
  KO
K18567  MFS transporter, DHA1 family, purine base/nucleoside efflux pump
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU05800 (pbuE)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    BSU05800 (pbuE)
SSDB
Motif
Pfam: MFS_1 MFS_4 Sugar_tr
Other DBs
NCBI-GeneID: 937996
NCBI-ProteinID: NP_388461
Pasteur: BG12189
BSORF: BG12189
UniProt: Q797E3 A0A6M3Z811
Position
complement(625125..626291)
AA seq 388 aa
MNFKVFLLAASTIAVGLVELIVGGILPQIANDLDISIVSAGQLISVFALGYAVSGPLLLA
LTAKIERKRLYLIALFVFFLSNLVAYFSPNFATLMVSRVLAAMSTGLIVVLSLTIAPKIV
APEYRARAIGIIFMGFSSAIALGVPLGILISDSFGWRILFLGIGLLALISMLIISIFFER
IPAEKMIPFREQLKTIGNLKIASSHLVTMFTLAGHYTLYAYFAPFLEETLHLSSFWVSIC
YFLFGISAVCGGPFGGALSDRLGSFKSILLVTGSFAIIMFLLPLSTSSMIFFLPVMVIWG
LLSWSLAPAQQSYLIEIAPDSSDIQQSFNTSALQVGIALGSAIGGVVLDQTGTVVSTAWC
GGSIVIIAVLFAFISLTRPVQTAKKSSL
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgaatttcaaagttttcctgcttgcagcttctacgattgcagtcggattggttgagtta
attgtggggggaattcttcctcagatcgcaaatgatttagacatttccattgtttcagcc
ggacagctgatcagtgtgtttgcgctgggatatgcagtatctgggccgctgcttttggca
ttgactgcgaagattgagcggaagcgcttatatctaattgctttatttgttttcttcctt
agcaatcttgtcgcctatttcagccctaatttcgcaacactgatggtatctagggtattg
gcagcaatgagtacagggctgattgttgtgctttctttaacaattgccccgaaaattgta
gcgcctgaatacagagcccgcgcaatcggaattatttttatgggattcagctctgctatc
gcattaggcgtgccgctcggaatcttaatcagcgattccttcgggtggcggattttgttc
cttggcatcggcctgttggcactgatctccatgctgattatttcaatcttctttgaaaga
ataccggcggagaaaatgattcctttccgggaacaactcaagacgatcggtaatctgaaa
atcgcgagttcacacctcgtcacgatgtttacattagctggccactacacgctttacgct
tactttgcgccgtttttagaagagactcttcacctgagctctttctgggtcagcatttgt
tatttccttttcgggatatctgctgtatgcggaggccctttcggaggagcgctatctgac
cggcttggttcctttaagagcattttgctggtgaccggttcctttgccatcattatgttc
ttactgccgctgtctacatcgtctatgattttctttttgcctgtcatggtgatttggggt
cttctgagctggagcctcgccccggctcagcaaagctatttaattgaaattgcacctgat
tcgtctgacattcagcaaagctttaacacatcggccctccaagtcggaattgcccttggc
tcagccattggcggtgttgttttggatcagacgggtactgtggtgtcaacggcatggtgc
ggcggatcgattgtgatcatcgctgtcctgtttgctttcatttctttaacaagacctgtt
caaacagcaaaaaaatcctccttgtaa

DBGET integrated database retrieval system