KEGG   Bacillus subtilis subsp. subtilis 168: BSU05810
Entry
BSU05810          CDS       T00010                                 

Symbol
gmuB
Name
(RefSeq) PTS system-oligo-beta-mannoside-specific transporter subunit IIB
  KO
K02760  cellobiose PTS system EIIB component [EC:2.7.1.196 2.7.1.205]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU05810 (gmuB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU05810 (gmuB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU05810 (gmuB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     BSU05810 (gmuB)
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     BSU05810 (gmuB)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU05810 (gmuB)
SSDB
Motif
Pfam: PTS_IIB
Other DBs
NCBI-GeneID: 938018
NCBI-ProteinID: NP_388462
Pasteur: BG12190
BSORF: BG12190
UniProt: O05505 A0A6M3Z823
Position
626622..626933
AA seq 103 aa
MKKILLACSSGMSTSLLVTKMKEYAQSIGEEAEIWAVGQDKAKEDMRKADAVLIGPQMSF
LKSELQKEADQYNIQVEVIDMMAYGMADGKKAYEQALSLMVNQ
NT seq 312 nt   +upstreamnt  +downstreamnt
ttgaaaaaaatattactcgcgtgcagttcaggaatgtctaccagtttattggtgacaaaa
atgaaggaatacgcacagtctatcggtgaggaagcggagatttgggctgttggccaggat
aaagcaaaagaagacatgagaaaagcggatgccgttttgatcggtccgcaaatgagcttt
ctgaaaagcgagctccaaaaagaagcagatcaatacaacattcaagttgaagtcattgac
atgatggcctacggaatggcagatgggaaaaaagcgtatgagcaggcattgtccttaatg
gtgaatcaataa

DBGET integrated database retrieval system