KEGG   Bacillus subtilis subsp. subtilis 168: BSU05820
Entry
BSU05820          CDS       T00010                                 

Symbol
gmuA
Name
(RefSeq) PTS system-oligo-beta-mannoside-specific transporter subunit IIA
  KO
K02759  cellobiose PTS system EIIA component [EC:2.7.1.196 2.7.1.205]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU05820 (gmuA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU05820 (gmuA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU05820 (gmuA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     BSU05820 (gmuA)
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     BSU05820 (gmuA)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU05820 (gmuA)
SSDB
Motif
Pfam: PTS_IIA Tab2-like_C DUF1771
Other DBs
NCBI-GeneID: 938039
NCBI-ProteinID: NP_388463
Pasteur: BG12191
BSORF: BG12191
UniProt: O05506 A0A6M3Z7X1
Position
626933..627265
AA seq 110 aa
MEQMKITNLTDEQISFQLILHSGNARSCIIQSLRAYKEGKKDEADALIAKAEQDLSAAHD
IHFQMIQKESGGEATAFSLLLMHAEDHLMSTLSMKELVKEMLDLFKTKNI
NT seq 333 nt   +upstreamnt  +downstreamnt
atggaacagatgaaaatcacgaatttaacagacgagcaaatcagttttcagctaatcctg
cacagcggaaatgcccgcagctgcatcatacaatcactgcgcgcctataaagaagggaaa
aaggacgaggctgatgccctcattgccaaggcggagcaggatttatccgcggcccatgac
attcactttcaaatgatacagaaggaatccggcggagaagcaacagctttttcattgctg
cttatgcatgcagaggatcatctgatgtcaacattatccatgaaagaattagtgaaagag
atgcttgatctctttaaaaccaagaatatataa

DBGET integrated database retrieval system