KEGG   Bacillus subtilis subsp. subtilis 168: BSU05830
Entry
BSU05830          CDS       T00010                                 

Symbol
gmuC
Name
(RefSeq) PTS system-oligo-beta-mannoside-specific transporter subunit IIC
  KO
K02761  cellobiose PTS system EIIC component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU05830 (gmuC)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU05830 (gmuC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU05830 (gmuC)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    BSU05830 (gmuC)
SSDB
Motif
Pfam: PTS_EIIC HATPase_c
Other DBs
NCBI-GeneID: 939882
NCBI-ProteinID: NP_388464
Pasteur: BG12192
BSORF: BG12192
UniProt: O05507 A0A6M4JJ13
Position
627284..628612
AA seq 442 aa
MFEKISQFLVPIAGRLNNNRYLQVLRDAFMLAFPLTIFGSIFVVLTNLPFLNKIMNASML
TSFQSHFGIASTATMGIMSVFVVFGIGYYLSKSYQVEAVFGGAIALVSFLLLTPFIIQPE
TGDAITGVIPVDRLGAKGMFLGMITAFLSGEIYRRIVQKNLTIKMPAGVPPAVAKSFAAL
IPAFITLTVFLLINVMVTLFFKTNMHDVIYHAIQAPLVGLGSGIIPTLIAVFFIQILWFF
GLHGQIIINSVMDPIWNTLQVENLSAYTAGKEIPHIISKPFMEIYTVGMGGTGMTLAIVF
TILIFMKSRQMKQVSKLGLAPGIFNVNEPIIFGLPIVMNPIIIVPWVLAPMVVTLVTYLA
MSAGLVPPPTGVTVPWTVPLFINGIMATNSIMGGVMQLINLLIVFVIWFPFLKAMDKLNL
AKEKEQAVQETAAQQNDNSIKM
NT seq 1329 nt   +upstreamnt  +downstreamnt
gtgttcgagaaaatcagccaattccttgttccaattgcagggaggttaaacaataaccgc
tatttgcaagtgttgcgtgatgcatttatgctggctttcccgctgacgatattcgggtcc
atttttgtcgtgttaacgaatttgccgtttctaaacaaaatcatgaacgcctcaatgctt
acgtcgtttcagtctcatttcggcattgcctccacggcgacaatgggcattatgtctgtc
tttgttgtgttcgggataggctattacctgtcgaaaagctatcaggtcgaagctgtattt
ggcggagcgatcgctttggtttcctttttgctcttaacgccatttatcattcagccggaa
acaggtgatgccattacaggggttatcccggtcgatcgtctcggtgcaaaagggatgttt
cttgggatgattacggcatttctttctggcgaaatttacagaagaatcgttcaaaaaaac
ctgacaatcaaaatgccagccggcgttccgcctgctgtagcaaaatcattcgccgcactt
attccggcttttatcacattgactgtatttttgctgattaacgtaatggtgactctgttt
tttaaaacaaatatgcacgacgtcatttatcatgcgattcaggctccgcttgtcggactt
ggaagcggtatcattccaacactgattgccgtgtttttcattcaaattctttggtttttc
ggactgcatggacagatcattatcaactccgtgatggacccgatttggaatacactgcag
gtagaaaacctttctgcttacacggcgggaaaagaaatccctcatattatttcaaaaccg
tttatggagatttatacagtagggatgggcggaacagggatgacgcttgcgattgtgttt
accattctcatattcatgaaaagcaggcagatgaagcaagtatcaaaacttggcctcgct
cccggtatttttaacgtaaacgaaccgattatctttgggcttccgattgtcatgaatccg
atcattattgtgccttgggtgctggcaccgatggttgttacgctcgtcacctatctggct
atgtcagccgggctcgttccgcctccaactggtgtgacagtgccgtggacggttccatta
ttcattaatggcatcatggcgacgaactcaatcatggggggcgtgatgcagcttatcaat
ctgctgattgtcttcgtgatctggtttccgttcctaaaagcaatggataaattaaatctg
gcaaaagaaaaagaacaggctgtgcaggagacagctgctcagcaaaatgataacagcata
aaaatgtga

DBGET integrated database retrieval system