KEGG   Bacillus subtilis subsp. subtilis 168: BSU05850
Entry
BSU05850          CDS       T00010                                 

Symbol
gmuR
Name
(RefSeq) GntR family transcriptional regulator
  KO
K03492  GntR family transcriptional regulator, regulator of glucomannan utilization
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU05850 (gmuR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU05850 (gmuR)
SSDB
Motif
Pfam: UTRA GntR HTH_DeoR MarR
Other DBs
NCBI-GeneID: 939879
NCBI-ProteinID: NP_388466
Pasteur: BG12194
BSORF: BG12194
UniProt: O05509 A0A6M3ZD82
Position
630170..630883
AA seq 237 aa
MNKYEIIANEMRNRIKNNVYPIDQPIPDEVSLAKEFNSSRMTMKRALDNLVAEGLLFRKR
GHGTFIIQSAIQDDHVHVVSNEILGLTNLLKDKKIKSKVIQFEVQFPTEEVAAHLSIDQK
TPVYYVVRLRIVEGEPYVLEKTYMPTHLIPGINDDVLHDSIYNHITNVLQLKIAGTHRKI
RACKSDHIDQQHLGCKQDDPILEVEHVGFLDTGIPFEYSFSRHRHDKFVVTSVNIRR
NT seq 714 nt   +upstreamnt  +downstreamnt
atgaataaatacgaaatcattgcaaatgaaatgagaaatagaattaaaaataacgtatat
ccgatcgatcagcccattcctgatgaagtatctcttgcaaaagaatttaactcaagccgc
atgacgatgaagagagccttggataatttagttgccgagggtctgctgtttagaaaacga
ggccatggcacgtttattattcaatctgcaatacaggatgaccatgtccatgtagtcagc
aatgagattctcggattgaccaacttgctgaaagataaaaaaatcaaaagcaaggtcatt
cagtttgaagtgcaatttcccactgaggaagtggccgcccatttgtctattgatcagaaa
acaccggtttattatgtcgttcggctgcgaattgtagaaggtgaaccctatgtattagaa
aaaacatatatgccgactcatttaataccgggcattaatgacgatgtccttcatgattcg
atctacaatcatattacaaatgtgctgcagctcaaaatcgccggaacgcatcggaaaatc
agagcctgcaaatctgatcatattgaccagcagcatctgggctgtaaacaggatgatcca
attcttgaagtggaacatgtgggcttcttagataccgggattccatttgaatattccttt
tcacgtcatcggcatgacaagtttgttgtgacttctgtaaacatacggcgctga

DBGET integrated database retrieval system