KEGG   Bacillus subtilis subsp. subtilis 168: BSU05870
Entry
BSU05870          CDS       T00010                                 

Symbol
gmuF
Name
(RefSeq) mannose-6-phosphate isomerase GmuF
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
bsu01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU05870 (gmuF)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU05870 (gmuF)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU05870 (gmuF)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BSU05870 (gmuF)
SSDB
Motif
Pfam: PMI_typeI_cat Cupin_2 AraC_binding PMI_typeI_C
Other DBs
NCBI-GeneID: 938028
NCBI-ProteinID: NP_388468
Pasteur: BG12196
BSORF: BG12196
UniProt: O05511 A0A6M3Z8F0
Position
631808..632755
AA seq 315 aa
MTHPLFLEPVFKERLWGGTKLRDAFGYAIPSQKTGECWAVSAHAHGSSSVKNGPLAGKTL
DQVWKDHPEIFGFPDGKVFPLLVKLLDANMDLSVQVHPDDDYAKLHENGDLGKTECWYII
DCKDDAELILGHHASTKEEFKQRIESGDWNGLLRRIKIKPGDFFYVPSGTLHALCKGTLV
LEIQQNSDTTYRVYDYDRCNDQGQKRTLHIEKAMEVITIPHIDKVHTPEVKEVGNAEIIV
YVQSDYFSVYKWKISGRAAFPSYQTYLLGSVLSGSGRIINNGIQYECNAGSHFILPAHFG
EFTIEGTCEFMISHP
NT seq 948 nt   +upstreamnt  +downstreamnt
atgacgcatccattatttttagagcctgtctttaaagaaagactatggggagggacgaag
cttcgtgacgcttttggctacgcaataccctcacaaaaaacaggtgagtgctgggccgtt
tctgcacatgcccatggctcgtcgtctgtaaaaaatggcccgctggcaggaaagacactt
gatcaagtatggaaagatcatccagagatattcgggtttccggatggtaaggtgtttccg
ctgctggtaaagctgctggacgccaatatggatctctccgtgcaagtccatcctgatgat
gattatgcaaaactgcacgaaaatggcgaccttggtaaaacggagtgctggtatatcatt
gattgcaaagatgacgccgaactaattttgggacatcatgcaagcacaaaggaagagttc
aaacaacgaatagaaagcggtgattggaacgggctgctgaggcgaatcaaaatcaagcca
ggagatttcttttatgtgccaagcggtacactccatgctttatgtaagggaacccttgtc
cttgaaatccagcaaaactctgatacaacatatcgcgtatacgattatgaccgctgtaat
gaccagggccaaaaaagaactcttcatatagaaaaagccatggaagtcataacgataccg
catatcgataaagtgcatacaccggaagtaaaagaagttggtaacgctgagatcattgtt
tatgtgcaatcagattatttctcagtgtacaaatggaagattagcggccgagctgctttt
ccttcatatcaaacctatttgctggggagtgttctgagcggatcaggacgaatcataaat
aatggtattcagtatgaatgcaatgcaggctcacactttattctgcctgcgcattttgga
gaatttacaatagaaggaacatgtgaattcatgatatctcatccttaa

DBGET integrated database retrieval system