KEGG   Bacillus subtilis subsp. subtilis 168: BSU05880
Entry
BSU05880          CDS       T00010                                 

Symbol
gmuG
Name
(RefSeq) mannan endo-1,4-beta-mannosidase
  KO
K01218  mannan endo-1,4-beta-mannosidase [EC:3.2.1.78]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
bsu01100  Metabolic pathways
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU05880 (gmuG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU05880 (gmuG)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.78  mannan endo-1,4-beta-mannosidase
     BSU05880 (gmuG)
SSDB
Motif
Pfam: Glyco_hydro_26
Other DBs
NCBI-GeneID: 938034
NCBI-ProteinID: NP_388469
Pasteur: BG12197
BSORF: BG12197
UniProt: O05512 A0A6M3Z7Z2
Structure
Position
632774..633862
AA seq 362 aa
MFKKHTISLLIIFLLASAVLAKPIEAHTVSPVNPNAQQTTKTVMNWLAHLPNRTENRVLS
GAFGGYSHDTFSMAEADRIRSATGQSPAIYGCDYARGWLETANIEDSIDVSCNGDLMSYW
KNGGIPQISLHLANPAFQSGHFKTPITNDQYKKILDSSTVEGKRLNAMLSKIADGLQELE
NQGVPVLFRPLHEMNGEWFWWGLTSYNQKDNERISLYKQLYKKIYHYMTDTRGLDHLIWV
YSPDANRDFKTDFYPGASYVDIVGLDAYFQDAYSINGYDQLTALNKPFAFTEVGPQTANG
SFDYSLFINAIKQKYPKTIYFLAWNDEWSAAVNKGASALYHDSWTLNKGEIWNGDSLTPI
VE
NT seq 1089 nt   +upstreamnt  +downstreamnt
ttgtttaagaaacatacgatctctttgctcattatatttttacttgcgtctgctgtttta
gcaaaaccaattgaagcgcatactgtgtcgcctgtgaatcctaatgcccagcagacaaca
aaaacagtgatgaactggcttgcgcacctgccgaaccgaacggaaaacagagtcctttcc
ggagcgttcggaggttacagccatgacacattttctatggctgaggctgatagaatccga
agcgccaccgggcaatcgcctgctatttatggctgcgattatgccagaggatggcttgaa
acagcaaatattgaagattcaatagatgtaagctgcaacggcgatttaatgtcgtattgg
aaaaatggcggaattccgcaaatcagtttgcacctggcgaaccctgcttttcagtcaggg
cattttaaaacaccgattacaaatgatcagtataaaaaaatactagattcttcaacagta
gaaggaaagcggctaaatgccatgctcagcaaaattgctgacggacttcaagagttggag
aaccaaggtgtgcctgttctgttcaggccgctgcatgaaatgaacggcgaatggttttgg
tggggactcacatcatataaccaaaaggataatgaaagaatctctctatataaacagctc
tacaagaaaatctatcattatatgaccgacacaagaggacttgatcatttgatttgggtt
tactctcccgacgccaaccgagattttaaaactgatttttacccgggcgcgtcttacgtg
gatattgtcggattagatgcgtattttcaagatgcctactcgatcaatggatacgatcag
ctaacagcgcttaataaaccatttgcttttacagaagtcggcccgcaaacagcaaacggc
agcttcgattacagcctgttcatcaatgcaataaaacaaaaatatcctaaaaccatttac
tttctggcatggaatgatgaatggagcgcagcagtaaacaagggtgcttcagctttatat
catgacagctggacactcaacaagggagaaatatggaatggtgattctttaacgccaatc
gttgagtga

DBGET integrated database retrieval system