KEGG   Bacillus subtilis subsp. subtilis 168: BSU05910
Entry
BSU05910          CDS       T00010                                 

Gene name
ydiB
Definition
(RefSeq) ATP-binding protein YdiB
  KO
K06925  tRNA threonylcarbamoyladenosine biosynthesis protein TsaE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU05910 (ydiB)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BSU05910 (ydiB)
SSDB
Motif
Pfam: TsaE dNK AAA_33
Other DBs
NCBI-GeneID: 938047
NCBI-ProteinID: NP_388472
Pasteur: BG12199
BSORF: BG12199
UniProt: O05515
Structure
PDB: 
5MVR 5NP9

Position
641654..642130
AA seq 158 aa
MKQLKWRTVNPEETKAIAKLTAAFAKPGDVLTLEGDLGAGKTTFTKGFAEGLGITRIVNS
PTFTIIKEYNDGVLPLYHMDVYRMEDESEDLGLDEYFHGQGVCLVEWAHLIEEQLPQERL
QIVIKRAGDDEREITFTAVGNRYEMLCEELSRHDNISN
NT seq 477 nt   +upstreamnt  +downstreamnt
gtgaagcaattaaaatggagaactgtaaatccagaagaaacaaaagcaattgccaagctg
acggcagcgtttgctaaaccgggagacgtcctgacattagagggcgatttaggtgcagga
aaaacgacttttacgaaaggttttgcagaagggctgggaattacacgtattgtaaacagt
ccgacttttacaattataaaagaatataacgatggcgtacttcctctttatcacatggat
gtgtatagaatggaagatgaaagtgaagatttgggacttgatgaatattttcacggacaa
ggtgtctgtctcgttgaatgggctcatttaattgaagaacagctgccacaggagcgactg
caaattgtcatcaaaagagctggtgatgatgagcgggaaattacctttactgctgtcggg
aatcggtatgaaatgctttgtgaggagttaagtagacatgacaatattagcaattga

DBGET integrated database retrieval system