KEGG   Bacillus subtilis subsp. subtilis 168: BSU05920
Entry
BSU05920          CDS       T00010                                 

Symbol
ydiC
Name
(RefSeq) hypothetical protein
  KO
K14742  tRNA threonylcarbamoyladenosine biosynthesis protein TsaB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU05920 (ydiC)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BSU05920 (ydiC)
SSDB
Motif
Pfam: TsaD RuvX
Other DBs
NCBI-GeneID: 939874
NCBI-ProteinID: NP_388473
Pasteur: BG12200
BSORF: BG12200
UniProt: O05516 A0A6M3Z834
Position
642111..642800
AA seq 229 aa
MTILAIDTSNYTLGIALLREDTVIAEYITYLKKNHSVRAMPAVHSLLNDCDMAPQDLSKI
VVAKGPGSYTGVRIGVTLAKTLAWSLDIPISAVSSLETLAANGRHFDGLISPIFDARRGQ
VYTGLYQYKNGLLEQVVPDQNVMLADWLEMLKEKDRPVLFLGHDTSLHKQMIEDVLGTKG
FIGTAAQHNPRPSELAFLGKEKEAADVHGLVPDYLRLAEAEAKWIESQK
NT seq 690 nt   +upstreamnt  +downstreamnt
atgacaatattagcaattgatacatcaaattatacattgggcattgcgctgcttcgagaa
gacactgttatagcagaatacattacatatttgaaaaagaaccactctgtaagagcgatg
cctgctgttcattcattgctgaatgattgtgatatggcaccgcaggacctttctaaaatt
gtcgttgcaaaaggccctggttcatacacaggagtaagaataggtgtgacgttggccaaa
acacttgcctggtctttagacattccaataagtgctgtatcaagtcttgagacgcttgcg
gcaaatggccggcattttgacggtctgatcagcccaatctttgatgctagacggggacag
gtgtacacaggtctgtatcaatataaaaatgggcttttagagcaagttgttccagatcaa
aatgtgatgctggcagattggctggagatgctaaaagaaaaggaccgccctgttttgttt
ttaggccatgatacttctcttcacaagcagatgatcgaggatgtgcttggaacaaaagga
ttcattggaactgccgcccagcataacccgcgcccttcagaattggcttttctcgggaag
gaaaaggaagcagctgatgttcatgggcttgtcccggattacttgcggctggcagaagct
gaagcgaaatggattgaaagtcaaaagtag

DBGET integrated database retrieval system