KEGG   Bacillus subtilis subsp. subtilis 168: BSU05930
Entry
BSU05930          CDS       T00010                                 

Symbol
rimI
Name
(RefSeq) ribosomal-protein-alanine acetyltransferase
  KO
K03789  [ribosomal protein S18]-alanine N-acetyltransferase [EC:2.3.1.266]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU05930 (rimI)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.266  [ribosomal protein S18]-alanine N-acetyltransferase
     BSU05930 (rimI)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  ribosomal protein modification factors
   BSU05930 (rimI)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_3 Acetyltransf_8 Acetyltransf_9 FR47 Acetyltransf_6 Acetyltransf_4 Acetyltransf_CG
Other DBs
NCBI-GeneID: 937997
NCBI-ProteinID: NP_388474
Pasteur: BG12201
BSORF: BG12201
UniProt: O05517 A0A6M3Z7Y0
Position
642810..643265
AA seq 151 aa
MKTKAAVRNMRLEDIDHVYEIEASSFTSPWTKDSFYHELLENPYAHYLVIEKDGHLAGYC
GIWIVMDDAQITNIAIKPEYRGQSLGETLFRSAVELCKEKDARRLSLEVRVSNHPAQGLY
KKFGMQPGGIRKNYYTDNGEDALIMWVTINE
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaaacaaaagcagcggtcagaaatatgcggcttgaagatatagatcacgtatacgaa
atcgaagcatcctcctttacgtctccttggacgaaggattcgttttatcatgagctgctg
gaaaatccgtatgctcattatctcgtgattgaaaaggacggccatcttgctgggtattgc
gggatttggattgtgatggacgatgcccagattacaaatatagcgataaaaccagagtat
cgcggccagtctttaggagaaacgctttttcgctcagctgttgaactgtgcaaagaaaaa
gacgcaaggcggctttcgcttgaagtgagggtttcgaatcatcctgctcaaggcttatat
aagaaattcgggatgcagcccggcggaataagaaagaactattatactgataacggggaa
gatgcgttaattatgtgggtgacgataaatgagtga

DBGET integrated database retrieval system