KEGG   Bacillus subtilis subsp. subtilis 168: BSU05940
Entry
BSU05940          CDS       T00010                                 

Symbol
gcp
Name
(RefSeq) tRNA threonylcarbamoyladenosine biosynthesis protein Gcp
  KO
K01409  N6-L-threonylcarbamoyladenine synthase [EC:2.3.1.234]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU05940 (gcp)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.234  N6-L-threonylcarbamoyladenine synthase
     BSU05940 (gcp)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  tRNA modification factors
   KEOPS/EKC complex
    BSU05940 (gcp)
 Prokaryotic type
    BSU05940 (gcp)
SSDB
Motif
Pfam: TsaD Carbam_trans_N BcrAD_BadFG
Other DBs
NCBI-GeneID: 938020
NCBI-ProteinID: NP_388475
Pasteur: BG12202
BSORF: BG12202
UniProt: O05518 A0A6M3ZB69
Position
643258..644298
AA seq 346 aa
MSEQKDMYVLGIETSCDETAAAIVKNGKEIISNVVASQIESHKRFGGVVPEIASRHHVEQ
ITLVIEEAFRKAGMTYSDIDAIAVTEGPGLVGALLIGVNAAKALSFAYNIPLVGVHHIAG
HIYANRLVEDIVFPALALVVSGGHTELVYMKEHGSFEVIGETLDDAAGEAYDKVARTMGL
PYPGGPQIDKLAEKGNDNIPLPRAWLEEGSYNFSFSGLKSAVINTLHNASQKGQEIAPED
LSASFQNSVIDVLVTKTARAAKEYDVKQVLLAGGVAANRGLRAALEKEFAQHEGITLVIP
PLALCTDNAAMIAAAGTIAFEKGIRGAYDMNGQPGLELTSYQSLTR
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgagtgagcaaaaagacatgtacgtattaggaattgaaacaagctgtgatgagactgct
gcagctattgtgaaaaacgggaaagagatcatttcaaacgtagtagcctctcaaattgaa
agccataagcgcttcggaggcgttgttccggaaattgcttcaagacatcatgttgaacaa
atcactttggttatagaagaggcgtttcgcaaagctggcatgacgtatagtgatattgat
gcgattgcagtaacagaaggtccgggactggtgggagcgcttcttatcggagtgaatgcc
gctaaagcattgagctttgcatataacattccgttagtaggcgttcatcatatagccggt
catatatacgcgaaccgtcttgtagaagacatcgtgttcccggcactggcattggtcgtt
tcaggaggccatacagaactggtttatatgaaggaacatggatcatttgaagtcattggg
gaaacccttgatgatgcggcaggagaagcctacgacaaagtggcgcggacgatgggattg
ccatatccgggtggaccgcaaattgacaagctagctgaaaaagggaatgacaatattccg
cttcctcgcgcatggcttgaagaaggctcttacaacttcagctttagcggattgaagtct
gcggtgatcaatacgcttcataatgcatcccaaaaagggcaagagattgctccggaagat
ttgtctgccagtttccaaaatagtgtgatcgatgtcttggtaaccaaaacggcgcgcgcg
gcaaaggaatatgatgtcaaacaggtccttttagccggaggagtagctgcaaacagaggc
ctcagagctgcattagaaaaggaatttgcccagcatgaagggattacgcttgtcattcct
ccattagctttatgcacggataatgctgcgatgattgctgctgctggtacaattgctttt
gaaaaaggaattcgcggtgcatatgatatgaatggccagcccggccttgaattgacttct
tatcaaagtctcacgagataa

DBGET integrated database retrieval system