KEGG   Bacillus subtilis subsp. subtilis 168: BSU05960
Entry
BSU05960          CDS       T00010                                 

Symbol
moaC
Name
(RefSeq) cyclic pyranopterin monophosphate synthase accessory protein
  KO
K03637  cyclic pyranopterin monophosphate synthase [EC:4.6.1.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
bsu04122  Sulfur relay system
Module
bsu_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU05960 (moaC)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BSU05960 (moaC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.17  cyclic pyranopterin monophosphate synthase
     BSU05960 (moaC)
SSDB
Motif
Pfam: MoaC
Other DBs
NCBI-GeneID: 939875
NCBI-ProteinID: NP_388477
Pasteur: BG12204
BSORF: BG12204
UniProt: O05520 A0A6M3ZD94
Position
646582..647094
AA seq 170 aa
MNGFSHFNEQGRAQMVDISEKSSTVRTAAAVSSVHMKNEVYEKIQSHDIGKGDVLAVAQV
AGIMAAKQTSNIIPMCHPLSLSGVDISFDWKIKEAEVILHIKAQVKTKGSTGVEMEALTS
ASVCALTVYDMCKALDKGMVIGPTFLLEKTGGKNGDFKRELSEYNLEDQK
NT seq 513 nt   +upstreamnt  +downstreamnt
atgaatggattttctcattttaatgaacagggcagagcccagatggtggatattagcgaa
aaatcttcgactgtccgtactgcggcggctgtttcaagcgtacacatgaagaatgaagtg
tacgagaaaatacaaagtcacgatatcggcaaaggagatgtactggctgtcgcacaggtg
gcaggcattatggccgcaaagcaaacgtcgaatatcattccgatgtgccatccgctttca
ttgagcggggtagatatatcgtttgactggaaaataaaagaagcagaagttatacttcat
ataaaagcacaggtcaaaacgaaagggagtacaggtgtggaaatggaagcgctcacttct
gcatcggtgtgcgctcttaccgtttacgatatgtgcaaggcccttgataagggaatggtc
atcggccctactttcttgctggagaagacaggcgggaaaaacggtgactttaaaagagaa
ctatccgagtataatttggaggaccaaaaatga

DBGET integrated database retrieval system