KEGG   Bacillus subtilis subsp. subtilis 168: BSU05970
Entry
BSU05970          CDS       T00010                                 

Symbol
ydiH
Name
(RefSeq) redox-sensing transcriptional repressor rex
  KO
K01926  redox-sensing transcriptional repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU05970 (ydiH)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU05970 (ydiH)
SSDB
Motif
Pfam: CoA_binding Put_DNA-bind_N HTH_DeoR HTH_11
Other DBs
NCBI-GeneID: 939871
NCBI-ProteinID: NP_388478
Pasteur: BG12205
BSORF: BG12205
UniProt: O05521 A0A6M3Z8L9
Structure
Position
647091..647738
AA seq 215 aa
MNKDQSKIPQATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGAL
GKKGYGYNVDYLLSFFRKTLDQDEMTDVILIGVGNLGTAFLHYNFTKNNNTKISMAFDIN
ESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPAR
LNVPEHIRIHHIDLAVELQSLVYFLKHYSVLEEIE
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaataaggatcaatcaaaaattccgcaggcgacggcgaaacggctgccgctttactat
cgctttttaaagaatctgcatgcgtcaggaaaacagcgtgtatcatccgctgaactcagt
gatgccgtaaaggttgattctgccacgattcggagggatttttcctattttggagctctt
ggcaaaaaaggatacggatataatgtggattatttgctgtcttttttccggaaaacgctt
gatcaggatgagatgacagacgtcatcttgattggtgtcgggaacttgggaacggcattt
cttcactataatttcacaaaaaacaataacacaaaaatttctatggcttttgatataaat
gagagtaaaataggaactgaggtaggcggcgtgcccgtctataaccttgatgaccttgaa
caacacgtaaaagatgaatcagttgccattcttacagtgccagcagttgccgctcaatcc
attacagacagattggtcgcattaggaatcaagggaatccttaattttacgccggcccgt
ttgaatgtgccggaacacattcgaattcatcatatagatttagcagttgagcttcagtca
ctggtttattttttgaagcattattcagttttagaggaaatcgaatag

DBGET integrated database retrieval system