KEGG   Bacillus subtilis subsp. subtilis 168: BSU05990
Entry
BSU05990          CDS       T00010                                 

Symbol
tatCY
Name
(RefSeq) Sec-independent protein translocase protein TatCy
  KO
K03118  sec-independent protein translocase protein TatC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
bsu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU05990 (tatCY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU05990 (tatCY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU05990 (tatCY)
Secretion system [BR:bsu02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   BSU05990 (tatCY)
SSDB
Motif
Pfam: TatC
Other DBs
NCBI-GeneID: 938010
NCBI-ProteinID: NP_388480
Pasteur: BG12207
BSORF: BG12207
UniProt: O05523 A0A6M3Z801
Position
647940..648704
AA seq 254 aa
MTRMKVNQMSLLEHIAELRKRLLIVALAFVVFFIAGFFLAKPIIVYLQETDEAKQLTLNA
FNLTDPLYVFMQFAFIIGIVLTSPVILYQLWAFVSPGLYEKERKVTLSYIPVSILLFLAG
LSFSYYILFPFVVDFMKRISQDLNVNQVIGINEYFHFLLQLTIPFGLLFQMPVILMFLTR
LGIVTPMFLAKIRKYAYFTLLVIAALITPPELLSHMMVTVPLLILYEISILISKAAYRKA
QKSSAADRDVSSGQ
NT seq 765 nt   +upstreamnt  +downstreamnt
atgacacgaatgaaagtgaatcaaatgtcgctgctggagcatattgctgagcttcgaaaa
cggttgctgattgtagcgctggcgtttgtcgttttctttattgctggattttttttagca
aagccgattattgtgtatctgcaagaaacagatgaagcgaagcagcttacgcttaacgcg
tttaacctgacagacccgctttatgtgtttatgcaatttgcgtttatcatcggcatagtc
ttgacctcgccggttattctttatcagctttgggcttttgtgagcccgggcctctatgag
aaagagcgcaaagtaacgctcagctacattccggtctctattttgctgtttttagcgggc
ttatctttttcatattatattttatttccttttgttgttgattttatgaagcggatttct
caggacttgaatgtcaatcaggtgatcggaattaatgaatattttcattttcttctgcag
ctgacgattccgtttggactgctgttccaaatgccggtcatcctcatgtttttgacaagg
ctcggaattgtgacaccgatgttcttggcgaaaatcagaaagtatgcgtattttacgctg
ctggtgatcgcagccctgattacaccgcctgagcttctgtcccatatgatggtcacagtc
ccgcttttgattttatatgaaatcagtatccttatatcgaaggccgcttatcggaaagca
cagaaaagcagtgctgccgatcgggacgtgtcttctgggcaataa

DBGET integrated database retrieval system