KEGG   Bacillus subtilis subsp. subtilis 168: BSU06000
Entry
BSU06000          CDS       T00010                                 

Symbol
ydiK
Name
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4305 7TM_GPCR_Srj
Other DBs
NCBI-GeneID: 939870
NCBI-ProteinID: NP_388481
Pasteur: BG12208
BSORF: BG12208
UniProt: O05524 A0A6M4JFN1
Position
complement(648742..648933)
AA seq 63 aa
MRNPVVWGMIYFAVGCIFTYLAASSPGSMWSFYSILLMVFAAYNISISFKMFAFSFKIKK
NQK
NT seq 192 nt   +upstreamnt  +downstreamnt
atgagaaacccggtagtttggggaatgatctactttgccgtagggtgcatctttacttat
cttgccgcaagctcgccaggcagcatgtggtcattttactccatcctgctgatggtgttc
gccgcttacaacatcagcatttcttttaagatgttcgccttttcatttaaaatcaaaaag
aaccaaaaataa

DBGET integrated database retrieval system