KEGG   Bacillus subtilis subsp. subtilis 168: BSU06010
Entry
BSU06010          CDS       T00010                                 

Symbol
ydiL
Name
(RefSeq) membrane peptidase YdiL
  KO
K07052  CAAX protease family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU06010 (ydiL)
Peptidases and inhibitors [BR:bsu01002]
 Glutamic peptidases
  Family G5: prenyl protease 2 family
   BSU06010 (ydiL)
SSDB
Motif
Pfam: Rce1-like ECSCR
Other DBs
NCBI-GeneID: 938033
NCBI-ProteinID: NP_388482
Pasteur: BG12209
BSORF: BG12209
UniProt: O05525 A0A6M3Z824
Position
complement(648930..649664)
AA seq 244 aa
MRKQYWFIILTYIIMQFSALIAIPLLFKFGYAGGQPTDENMLHAQGLWSVISFIACLVVV
LLILRTVPKETLRNGQKDSIGLSILWAIAGFFIALFSQGIAGSIEYYVFGIGRESENTQA
ILDVIQAVPLMIIVSSIVGPILEEIIFRKIIFGALYEKTNFFFAGLISSVIFGIVHADLK
HLLLYTAMGFTFAFLYARTKRIWVPIFAHLMMNTFVVIMQLEPVRNYLEQQSTQMQLIIG
GLFL
NT seq 735 nt   +upstreamnt  +downstreamnt
ttgagaaaacagtattggtttattattttgacatatatcatcatgcagttttccgcatta
atcgcgattcccttgttatttaaattcggttatgccggaggacagcctacagatgaaaat
atgctgcatgcacaaggattatggtccgttatcagctttatcgcctgtctcgttgttgtt
ctgctcattctgagaaccgttccgaaagaaacgctgcgaaacggacagaaggactcaatc
ggactttctatcctttgggcgatagccggttttttcattgcccttttctctcaaggaata
gcaggctctattgaatattatgtttttggcatcggaagagaatcagaaaatacacaagcg
attctggatgtcattcaggcagtcccgctcatgattatcgtttcttccatcgtcgggcct
atattagaagaaatcatcttcagaaaaatcattttcggcgcgctgtacgaaaaaacgaat
ttctttttcgcaggactgatcagctcggttatcttcggtattgttcacgctgatttgaag
catctccttctatatacagcaatgggctttacctttgcctttttatatgcgagaacaaaa
cggatatgggtgccgattttcgcccatttaatgatgaatacattcgtcgtcatcatgcag
cttgagcctgttcgtaattaccttgaacagcagagcacacaaatgcaattgattattgga
ggattatttttatga

DBGET integrated database retrieval system