KEGG   Bacillus subtilis subsp. subtilis 168: BSU06020
Entry
BSU06020          CDS       T00010                                 

Symbol
groES
Name
(RefSeq) chaperonin
  KO
K04078  chaperonin GroES
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU06020 (groES)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU06020 (groES)
Chaperones and folding catalysts [BR:bsu03110]
 Heat shock proteins
  HSP10
   BSU06020 (groES)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    BSU06020 (groES)
SSDB
Motif
Pfam: Cpn10
Other DBs
NCBI-GeneID: 938006
NCBI-ProteinID: NP_388483
Pasteur: BG10422
BSORF: BG10422
UniProt: P28599 A0A6M4JDU6
Position
649903..650187
AA seq 94 aa
MLKPLGDRVVIELVESEEKTASGIVLPDSAKEKPQEGKIVAAGSGRVLESGERVALEVKE
GDRIIFSKYAGTEVKYEGTEYLILRESDILAVIG
NT seq 285 nt   +upstreamnt  +downstreamnt
ttgttaaagccattaggtgatcgcgttgtcattgaactcgtagaatctgaagaaaaaact
gccagcggaattgtgttgccggattctgcaaaagaaaaaccgcaagaaggcaaaatcgtg
gcagctggttcaggtcgcgtgttagaaagcggagagcgcgttgctttagaagtaaaagag
ggcgaccgcattatcttctcaaaatacgcaggtactgaagtgaaatacgaaggtactgaa
tacttaatcttacgtgaaagcgacattttagctgttatcggctaa

DBGET integrated database retrieval system