KEGG   Bacillus subtilis subsp. subtilis 168: BSU06030
Entry
BSU06030          CDS       T00010                                 

Symbol
groEL
Name
(RefSeq) chaperonin
  KO
K04077  chaperonin GroEL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU06030 (groEL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU06030 (groEL)
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU06030 (groEL)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU06030 (groEL)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU06030 (groEL)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     BSU06030 (groEL)
Chaperones and folding catalysts [BR:bsu03110]
 Heat shock proteins
  HSP60 / Chaperonin
   BSU06030 (groEL)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    BSU06030 (groEL)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BSU06030 (groEL)
  Exosomal proteins of other body fluids (saliva and urine)
   BSU06030 (groEL)
  Exosomal proteins of breast cancer cells
   BSU06030 (groEL)
  Exosomal proteins of colorectal cancer cells
   BSU06030 (groEL)
  Exosomal proteins of bladder cancer cells
   BSU06030 (groEL)
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-GeneID: 938045
NCBI-ProteinID: NP_388484
Pasteur: BG10423
BSORF: BG10423
UniProt: P28598 A0A6M3Z7Y6
Position
650234..651868
AA seq 544 aa
MAKEIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE
LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGME
QAVAVAIENLKEISKPIEGKESIAQVAAISAADEEVGSLIAEAMERVGNDGVITIEESKG
FTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVVQ
QGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGGEVIT
EDLGLDLKSTQIAQLGRASKVVVTKENTTIVEGAGETDKISARVTQIRAQVEETTSEFDR
EKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVNV
YNKVAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLEGSVIVERLKNEEIGVGFNAATG
EWVNMIEKGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENGGGAGMPDMGGMGGM
GGMM
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggcaaaagaaattaagtttagtgaagaagctcgccgcgcaatgcttcgcggtgtcgat
gcacttgctgatgctgttaaagtaactttaggaccaaaaggacgcaacgtggttctagag
aaaaaattcggttctccgttaatcacaaatgacggtgtaacaatcgctaaagaaatcgag
ctagaagacgcgtttgaaaacatgggtgctaagcttgttgctgaagtagccagcaaaaca
aacgacgttgccggtgacggtacaacaactgcaacagttcttgcgcaagcaatgatccgt
gaaggccttaaaaacgtaacagcaggcgctaaccctgtaggcgtgcgtaaagggatggaa
caagctgtagcggttgcgatcgaaaacttaaaagaaatttctaagccaatcgaaggcaaa
gagtctatcgctcaggttgctgcgatctctgctgctgatgaggaagtcggaagccttatc
gctgaagcaatggagcgcgtaggaaacgacggcgttatcacaatcgaagagtctaaaggc
ttcacaactgagcttgaagttgttgaaggtatgcaattcgaccgcggatatgcgtctcct
tacatggtaactgactctgataagatggaagcggttcttgacaatccttacatcttaatc
acagacaaaaaaatcacaaacattcaagaaatccttcctgtgcttgagcaggttgttcag
caaggcaaaccattgcttctgatcgctgaggatgttgaaggcgaagcacttgctacactt
gttgtgaacaaacttcgcggcacattcaacgcagtggctgttaaagctcctggtttcggt
gatcgccgtaaagcaatgcttgaagacatcgctgtccttactggcggagaagtcatcaca
gaagatcttggccttgacctgaaatctactcaaatcgctcaattgggacgcgcttctaaa
gttgtcgttactaaagaaaacacaacaatcgttgaaggcgctggcgaaacagacaaaatt
tctgcccgtgtgactcaaatccgcgctcaagtggaagaaacaacttctgaattcgacaga
gaaaaattacaagagcgtcttgctaaacttgctggcggcgtagctgtcatcaaagtcggc
gctgcgactgaaactgagctgaaagagcgtaaacttcgcatcgaagacgccttgaactca
actcgcgcagctgttgaagaaggcatcgtatccggtggtggtacagcgcttgtaaacgta
tataacaaagtcgctgcagttgaagctgaaggcgatgctcaaacaggtatcaacatcgtg
cttcgcgcgcttgaagagccaatccgtcaaatcgcacacaacgctggccttgaaggatct
gtcatcgttgagcgcctcaaaaacgaagaaatcggcgtaggcttcaacgctgcaactggc
gaatgggtaaacatgatcgaaaaaggtatcgttgacccaacaaaagttacacgctcagct
cttcaaaacgctgcgtctgtagctgcaatgttcttaacaacagaagctgttgtcgctgac
aagccagaagaaaacggtggcggcgcaggaatgcctgatatgggcggcatgggcggtatg
ggtggaatgatgtaa

DBGET integrated database retrieval system