KEGG   Bacillus subtilis subsp. subtilis 168: BSU06040
Entry
BSU06040          CDS       T00010                                 

Symbol
ydiM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939886
NCBI-ProteinID: NP_388485
Pasteur: BG12785
BSORF: BG12785
UniProt: O34672 A0A6M4JJ33
Position
653432..653812
AA seq 126 aa
MLSDNNFVSETLENVQYLLPGAKVIKLRGYSRAHKVYTIAKSPVEKWKVAAGLSGSEIAI
LIRKGHWIGASIPAGGIVIDIDDSKQGELVKGLLDAQNFHCHCIRTLMGGSLFLRITNMG
KRKLNK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgctaagtgataataattttgtttccgaaacactggagaatgtacagtatctattgcca
ggtgcaaaagtaatcaaattgaggggatacagcagggcccacaaagtatacaccattgca
aaatccccggtagaaaagtggaaggtcgccgcaggtttatccggatcagagatagcaatt
ctgattagaaaaggtcattggattggtgcaagcattccagctggcggaattgtcatcgat
attgatgattcaaaacagggagagctagtgaaaggtttactagatgcgcaaaactttcat
tgtcattgtattaggaccctaatgggtggcagtttatttttaaggataaccaacatgggg
aaaagaaaattaaacaaataa

DBGET integrated database retrieval system