KEGG   Bacillus subtilis subsp. subtilis 168: BSU06048
Entry
BSU06048          CDS       T00010                                 

Symbol
ydzU
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8302904
NCBI-ProteinID: YP_003097688
UniProt: C0H3W7 A0A6M3Z8C4
Position
654071..654343
AA seq 90 aa
MKAWKVEPYEISKAMELIYKYLLLDKKDFSLEEFYKLTIYAIKWKLEQAQFPLYLESTKK
SHQNVIPQPFKIKGNVLYKTVIKNSGDFEE
NT seq 273 nt   +upstreamnt  +downstreamnt
ttgaaagcctggaaggtggaaccatacgaaattagcaaggccatggaattgatttataaa
taccttctgctggataaaaaagatttctctttggaggaattttataaactcaccatatat
gctatcaaatggaaactggaacaagctcagtttccattgtatttagaatccacaaaaaaa
tcgcatcaaaatgttattccccagccgtttaagataaaaggaaatgtcttatataaaacg
gtaatcaagaatagcggggactttgaagaatag

DBGET integrated database retrieval system