KEGG   Bacillus subtilis subsp. subtilis 168: BSU06060Help
Entry
BSU06060          CDS       T00010                                 

Gene name
ydiO
Definition
(RefSeq) BsuMI modification methylase subunit YdiO
  KO
K00558  DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU06060 (ydiO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU06060 (ydiO)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU06060 (ydiO)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:bsu02048]
    BSU06060 (ydiO)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     BSU06060 (ydiO)
DNA replication proteins [BR:bsu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    BSU06060 (ydiO)
Chromosome and associated proteins [BR:bsu03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    BSU06060 (ydiO)
Prokaryotic defense system [BR:bsu02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    BSU06060 (ydiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_methylase
Motif
Other DBs
NCBI-GeneID: 939892
NCBI-ProteinID: NP_388487
Pasteur: BG12787
BSORF: BG12787
UniProt: O34939
Position
655223..656506
Genome map
AA seq 427 aa AA seqDB search
MTNFILNENKQLSLAIEDENIENFYIDGTDLVRKIIRRSGSGVTSRVPVLSTQDLENKNL
HELYDESWLRMKNRPNTELTTESINIADLFSGCGGLSLGVWEACRALGINPRFSFACDLN
EAALSVYEKNFSPDFSLNESIEKHINGELGAPLTVEEQRIKDKVKKIDFILAGPPCQGHS
DLNNHTRRKDPRNALLMRVSRVIELFQPSSVLVENVPGIIHDKSGSFKEFKNHLKTQGYY
FDEIVLNAEKLGVSQARRRYFIFASKTPVSSLNQINEFYSTNSRPISWAISDLVENVGDD
IFNTASEHSLENKRRIEYLFENNLFELPNSERPDCHRLKPHSYKSVYGRMYWDRPAPTIT
RGFGSTGQGRFVHSLLKRTITPHEAARIQFFPDFFNFGDLRRRQYQDVIGNAVPSKLSYL
LALHQLR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattttattttaaatgaaaataaacagttatcattggcaattgaagatgagaac
atagaaaatttttatatagatggtacagatttagtccgaaagataatccgtagatcaggt
tcaggagttacatcacgggttccggtccttagcacccaagatttagaaaacaagaacctt
catgaattatacgatgaatcttggctccgtatgaaaaacagacccaatactgagctcact
actgagagtataaatattgcggatttatttagtggatgtggaggtctatccttaggggtt
tgggaggcatgccgtgccctggggataaatccaagattttcgtttgcttgtgatcttaac
gaagctgccttatctgtgtacgaaaaaaacttttctcccgattttagcttgaatgaatcc
atcgaaaaacatattaatggcgagttaggtgctccattaactgttgaagagcaaagaata
aaagataaggtgaaaaaaatagatttcattctagcaggtcctccttgccaagggcattct
gatcttaataaccatactagacgaaaagaccctagaaacgctttactaatgagagtaagt
agagttatagagttgttccaaccttcttcagtattagtggagaatgtaccaggaattatt
catgataaatctggttcttttaaagaatttaagaatcatttaaagacacaaggttattac
ttcgatgaaatcgtactaaatgctgaaaaactaggtgtttcacaagcacgtcgtagatat
tttatttttgcttcaaaaactcctgtatcttccttaaatcaaataaatgaattttattca
accaatagtaggccaattagttgggcaatatcagatttagtagaaaatgtaggtgatgat
atattcaacactgcttccgagcattcattggaaaacaaaaggagaatagaatatcttttt
gaaaataacttgtttgaattacctaattcagaaagaccggattgtcatcggctaaaacca
cattcatacaaatctgtgtatggcagaatgtattgggatagacctgctcccactataacc
agagggtttggatcaacaggtcaagggagatttgttcattctttgttaaagagaacgata
actccccatgaagcagctaggattcagttcttcccggacttttttaactttggtgacctt
cggaggagacagtatcaagacgttatcggtaatgctgtgccttccaaactatcctattta
ttagcattacatcaattaagataa

DBGET integrated database retrieval system