KEGG   Bacillus subtilis subsp. subtilis 168: BSU06090
Entry
BSU06090          CDS       T00010                                 

Symbol
ydiR
Name
(RefSeq) type-2 restriction enzyme BsuMI component YdiR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938002
NCBI-ProteinID: NP_388490
Pasteur: BG12790
BSORF: BG12790
UniProt: O35025 A0A6M3Z812
Position
659623..660564
AA seq 313 aa
MTFIKRLEDAYETLLGNYPAGVSSTSTSKYNEIRKIVSEAFLIGENEVYVTGTSRRISNL
DTRFAQGNQRNKHTRMAVAFISIPSVDDSELDELIIRTRNSAITTSSKFCNGEERGTIFD
GILLFLVFEGETKVYPLAFLVFENDFELKEKAEELIPGIELKEYPRANQSPAQENNKSAK
NEDEESAKSYVVFLDIEEDGSIVEFVEDKDKTYRIGDMIWTASHTNGSSAITRRLEVIEV
VENLVVCKIKHKYNEPVDKNSLLKFVNIEQDLISFLDLHPNVQNGSEGFVSGDIVDENAT
TSSDDLPEDFENN
NT seq 942 nt   +upstreamnt  +downstreamnt
atgacttttataaaaagattagaggacgcttatgaaactctattagggaattaccctgcc
ggagtatctagtaccagtactagtaagtataacgaaatacgaaagattgtttcagaagcc
ttcttgatcggtgaaaatgaagtgtatgtaacgggaacatcaagaaggattagcaatttg
gacactcggtttgctcaaggaaatcaacggaataaacatacccggatggcagttgctttt
atttctataccttctgtggacgattcggaattagatgaactaattataagaacgagaaat
agtgcaattacaacctcatctaaattctgtaacggggaagaaaggggcacgatttttgac
ggaatattactttttttagtatttgagggtgaaaccaaagtgtatccgctagcattctta
gttttcgagaacgattttgaattaaaggaaaaggctgaggaattgattccaggaattgaa
ctcaaagaatacccgcgagctaatcaatccccagcccaggaaaataacaaaagcgctaaa
aatgaagatgaggaaagtgcaaagagctatgtagtcttccttgatattgaggaagatggt
tctattgtggaatttgtagaagataaagacaaaacctatagaattggtgatatgatttgg
acggcttcacatactaatggttcatcagctatcacacgcagactggaagtaattgaagtc
gttgaaaatcttgtggtgtgtaagataaaacataaatataatgaacctgttgataagaat
tcactgcttaagtttgtaaatattgaacaagatttgatttcatttctagacttacatcca
aatgtccaaaatggaagtgagggatttgtatctggggacattgttgatgagaacgctact
acatcatcggatgacttaccggaagactttgaaaataactaa

DBGET integrated database retrieval system