KEGG   Bacillus subtilis subsp. subtilis 168: BSU06100
Entry
BSU06100          CDS       T00010                                 

Symbol
ydiS
Name
(RefSeq) type-2 restriction enzyme BsuMI component YdiS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AAA_5 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 938023
NCBI-ProteinID: NP_388491
Pasteur: BG12791
BSORF: BG12791
UniProt: O34885 A0A6M3Z7Y4
Position
660596..661627
AA seq 343 aa
MEISKQTSDLLLSLEKKKGTLPKFSVLRSIPRNRIIYGAPGTGKSNYLEREVGKIFGDNP
YVFTRVTFFPGYTYGQFIGAYKPVPIYKKLSGEEEIFSSNFRDKMENFEPMIDYQFVPGP
FIDVLIKALKNRYTNFILIIEEINRANAASVFGDIFQLLDRNKNGESDYPVTFGPDIMNY
LARNGIKDEMIKLPSNFFIWATMNNADQGVLPLDTAFKRRWSFEYLELEKYRKAVDSWKL
SLRYKGHNKVIMWNDFRDIINKRLKGKVPEDKLLGPFFLKESELWNQNVFKNKLLYYLKE
DVFKHNPTIDFLNASTFSELIEKYDGSDNIFTFDIDDSSFVSD
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggaaatatccaaacaaacttcagatttattattgagcctagaaaagaaaaaaggcact
ttaccaaaattcagcgttttacgcagtattcctaggaataggattatttatggtgcacca
ggaacagggaagagtaattatctagaaagggaagtgggaaagatctttggtgataatcca
tatgtattcacccgagttacttttttccctggttatacatatggacaatttataggtgct
tataaaccggttcctatatataaaaaattaagcggtgaggaagagatatttagttcaaac
tttagggataagatggaaaactttgagccaatgattgattatcaatttgttcctggccca
tttatcgatgtattaattaaagctctgaaaaatagatacactaattttatattaattatc
gaagaaattaatcgtgccaatgcagcaagtgtttttggtgatatttttcaattattagac
agaaataaaaacggtgaaagtgattatcctgttacattcgggccggacattatgaattat
ttagcgagaaacggaattaaagatgaaatgattaagctaccatccaatttctttatttgg
gcaactatgaataatgcggatcagggtgttttaccgctcgataccgcttttaagagaagg
tggtcatttgaatatttagagttggaaaagtatagaaaggcagtggactcttggaagctg
agcctcagatataaaggtcataataaagtaattatgtggaatgatttccgagacattatt
aataagcgtcttaaaggaaaagtaccagaggataagctgcttggaccttttttcctgaaa
gaaagtgaactgtggaatcagaatgtatttaaaaataaactgctttattatttgaaggaa
gatgttttcaagcataatccaacgattgattttttaaatgctagtactttctctgagcta
attgaaaaatatgatggctcggataacatttttacttttgacatagatgattcgtctttt
gtgagtgattaa

DBGET integrated database retrieval system