KEGG   Bacillus subtilis subsp. subtilis 168: BSU06110
Entry
BSU06110          CDS       T00010                                 

Symbol
ydjA
Name
(RefSeq) type-2 restriction enzyme BsuMI component YdjA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: RE_LlaJI
Other DBs
NCBI-GeneID: 939884
NCBI-ProteinID: NP_388492
Pasteur: BG12792
BSORF: BG12792
UniProt: O34303 A0A6M3Z828
Position
661630..663027
AA seq 465 aa
MDKSSKFFFEDQKYNKERIVRVLGGNLALLKSKGILYEDSSGDLIFNYVGVISNGRNVIF
ILPKYCNRHLDEHSKRTLFNKLLKIFKKYSGLNKSRESDYFVSELDSDEVSDFMIADYLL
NDFSLNGYYQKKFTEYEIDGEGIIDWSKTVNEITPVFSKGVPYYFSTYNEVVQKDEYHLI
VKIHKWALSKYFNDFGVILGFTGLEFDKSCDGMKILDYADFFGSVINKEIVNTYVDRDVK
LLKALKTAIDREENQFSKRPTLSLYGTKYFHRVWEEVCKTVFSHVNEYVKKISRPNWINF
TDIEVNKEKKTLEPDIIKAFEYRSKEYFLILDAKYYNINFDGKKLEGNPGVEDITKQLLY
DKALEKLSRGKTKHNAFLFPSSNSTNTFKVFGSVDFDFLDIAAVTLVYISAEQVYNLYLE
NKTFSTDDLFKFVSEINKSKKRHSVITSTLYGNMFLFTKRLSDKN
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggataagtcaagtaagttcttctttgaagatcaaaaatacaataaagaaaggattgta
cgtgtactcggtggtaatttagctttactcaaaagtaaaggtatattatatgaagattct
agtggggatttaatatttaactatgtaggtgttatatctaatgggcgcaatgtaatattc
attttgcctaaatactgtaacaggcacttagatgaacattcaaagcggactttgtttaat
aagttgctgaagatttttaaaaaatattcaggtttaaataaaagccgggaatctgattat
ttcgtatcggagctagatagtgatgaagtctccgactttatgatagcagattatttgctt
aatgatttctcattgaatgggtattatcaaaaaaaatttactgaatatgaaattgatgga
gaaggaattatagattggagtaagacagttaatgaaattaccccagtattctcaaaggga
gttccatattatttcagtacttataatgaagtggtacaaaaagacgagtatcacttgata
gttaaaattcataaatgggctttaagtaaatattttaatgatttcggagtcattttaggt
tttacgggactagaatttgataaatcctgtgatggtatgaaaattttggactacgctgat
ttttttggctcagtaataaataaagaaatcgtgaacacatatgttgatcgtgacgttaaa
ttgttaaaggcattgaaaaccgcaattgatagggaagagaatcagttttctaaacgaccc
actctttctctgtatggaacaaaatactttcacagagtatgggaggaagtatgtaagacc
gtattttcccatgttaatgaatacgtaaaaaagatatcaaggccaaattggattaacttt
acggatatagaggttaataaagagaaaaaaacactagaacccgatattattaaggctttc
gaataccgttcaaaagaatactttttaatattagatgctaaatattataatataaatttt
gacggaaaaaagctggaggggaatcctggggttgaagatataactaagcagctgttatat
gataaggcacttgaaaaactgtccagaggtaaaacaaaacataatgcttttctgtttcct
tcctctaattcaaccaatacctttaaagtatttggttctgttgattttgattttcttgat
atagccgctgtaactcttgtttatatttctgctgaacaagtttataacttatatcttgaa
aataaaacattttccactgatgacttatttaaatttgtaagtgaaattaataagtcaaaa
aaacgacatagcgttataacttcaacattgtatggtaatatgtttttgtttacaaaaaga
ttaagtgataaaaattag

DBGET integrated database retrieval system