KEGG   Bacillus subtilis subsp. subtilis 168: BSU06120
Entry
BSU06120          CDS       T00010                                 

Symbol
ydjB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 935917
NCBI-ProteinID: NP_388493
Pasteur: BG12793
BSORF: BG12793
UniProt: O34778 A0A6M3Z854
Position
663601..663936
AA seq 111 aa
MLNIKSDRIMTSDPQKFTVDGVRFFQQYLNKIRPDAMEIDNLIINSDIIKEDLIVHVSKM
IDRLALYDLHRKRSIDKHFSAAFTVDINDREEFYSANIADVSIDLNESSGV
NT seq 336 nt   +upstreamnt  +downstreamnt
atgttaaatataaagagcgacagaataatgacatctgatccccaaaaattcactgtcgat
ggagttagattcttccaacagtaccttaataaaatccgtcccgacgctatggagatagac
aacctaattatcaactctgatattatcaaggaggacttaatagtgcatgtctcaaaaatg
atagatcgtttggctttatatgatttacacagaaaaagaagcatagataaacatttttct
gctgcttttacagtcgatatcaatgatagagaggaattttacagtgcaaatatagctgat
gtttcaattgatttgaatgaatctagtggtgtttaa

DBGET integrated database retrieval system