KEGG   Bacillus subtilis subsp. subtilis 168: BSU06130
Entry
BSU06130          CDS       T00010                                 

Symbol
ydjC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Ser_hydrolase DUF2048 DUF6471
Other DBs
NCBI-GeneID: 936012
NCBI-ProteinID: NP_388494
Pasteur: BG12794
BSORF: BG12794
UniProt: O34715
Position
664319..664669
AA seq 116 aa
MVSIFYANRLSYSIWNTIPGKYIREELEQNGVTYNELIKYWDITDPSQALPKVNKDNVLL
ISAKHDQYIDLKDADYLWESWGRPTRYVYNCGHSGIVLCRKKLANDTLSFIREKLV
NT seq 351 nt   +upstreamnt  +downstreamnt
gtggtatctatcttttatgccaatcgcctttcttattcgatatggaacacgatcccaggt
aaatacataagagaagaattagaacaaaatggtgtgacctataatgagttaataaaatat
tgggatatcacagatcctagtcaagccttgccgaaagttaataaagataacgtactgctg
atttctgctaaacatgatcaatatattgacttgaaagatgcagattatttatgggaaagt
tgggggagacctacaagatatgtctacaattgtggtcattccggtattgttctttgtcgc
aaaaagctggcaaatgatacgctttcctttatacgagaaaaactggtttga

DBGET integrated database retrieval system