KEGG   Bacillus subtilis subsp. subtilis 168: BSU06140
Entry
BSU06140          CDS       T00010                                 

Symbol
gutR
Name
(RefSeq) transcription activator GutR
  KO
K16247  LuxR family transcriptional regulator, glucitol operon activator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU06140 (gutR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   LuxR family
    BSU06140 (gutR)
SSDB
Motif
Pfam: NB-ARC TPR_2 TPR_MalT TPR_12 TPR_7 TPR_19 TPR_1 NACHT TPR_8 AAA_16 AAA_25 AAA_22 TPR_11 LppC AAA_24 TPR_17 Suv3_N Rapsyn_N AAA_30 PPR AAA
Other DBs
NCBI-GeneID: 938026
NCBI-ProteinID: NP_388495
Pasteur: BG10178
BSORF: BG10178
UniProt: P39143 A0A6M3Z7Z6
Position
complement(664775..667264)
AA seq 829 aa
MAELENRKQFAQMLAPGVKTLKLHPDYKVRRKKNEKTGQSYIDKIALQLGVSPNTIKSWI
GQMGANYIPGRIDDGKLFGMIWIILEKTDLDIEWLTDLLEATTIPVIKPALPVWAASCLK
KAKILRKDGLFGAPSEGEIENVVKRLFHDRPGQETNALTEQPITHNLPSRWSGRFIGRSF
DMEAIRQWMLSPSPVCLITGWAGMGKTTIALEAAYSCVDDTSVWPAFNSIIWVSADWKGL
SFSDFLNTIAYQLGRKEQIDKSINVKRFVVRNALANYTREKPILLIVDSIDTAERDIHEF
ITSLPQGVKVLLTARENVKQTYRESFGEMTAIQLSGLDQTDAHEFFQQEVHHCLQTCNLP
RKREKLEQLLHLSSDLKNEFISATAGNPKAMALSIAYMSDDDIPAQQLIHELGKAGYSLL
ELFEFLFGRTWDRCNEDTRKLWQTLCFFSKPPDEKSLAAAAGLDARRFHYAMEQMRSYAL
IQPERSQGRTQYLAHQTVVAYGEQHLSEQHEYEKEARNRWAHYYIDYAETHLKREQPNSI
YWSYLLGRNLDQMKQEWPNILKVIQWASETEQKEILIELITRISHFLSRINLPLRIEYGR
KAADAAHHLGQHTREAYFRIDTSGWALMEVNDLDGALQQIEAGLKILEQSDAHDAYDLKV
WGHALKARLFLKDGQQEKAETILNEIENQPISPTIQHRVLLVRGDLSFARGYHVEAIQLY
EAANEISSTYGGEKTIEAYFNLGVAYVKCDQFEKAEEAFEQMLYDKHNANQVELIYYHYG
MAQLLYRKGEKTKAVESNQKAIRLIDSWEPAIGIRGEVERLARATKENE
NT seq 2490 nt   +upstreamnt  +downstreamnt
atggctgaacttgaaaaccgaaaacaatttgcacaaatgctggcacctggcgtcaaaacg
ctaaaacttcatcctgattataaagtcagaaggaaaaagaatgaaaaaacaggacagtct
tacatagataaaatcgcactccagctgggagtctccccaaacacgatcaaaagctggatc
ggacagatgggggcaaactacattcccggaagaatcgacgacggaaaactgttcggaatg
atctggatcattctcgaaaagaccgacttggatatcgagtggttgaccgacttgctggaa
gccaccactatcccagtcatcaaacccgcattgcctgtatgggcagcatcctgtttgaaa
aaagcgaaaatactgcgaaaagacggattattcggggctccgagtgaaggcgaaattgaa
aatgtagtaaaacggctgtttcatgacagacccggccaagaaacgaatgcgcttacagaa
cagcccatcacgcataatttaccctcacgctggtccggacgctttatcggacgcagcttt
gatatggaagcgatacggcaatggatgctttctccatcaccagtctgtttaatcaccggc
tgggccggcatgggaaaaaccacaattgctcttgaagccgcctattcctgtgtcgacgat
acttcagtttggccggcattcaacagcatcatctgggtcagcgctgattggaaaggatta
agctttagcgattttttaaatacgatcgcctatcagctcggacgcaaagaacaaatcgat
aaatcaatcaatgtaaaacggtttgtcgtccgcaatgcgttagccaattacactagagaa
aaaccgatcctgctgatcgttgacagcattgatactgcagaacgtgacattcatgaattt
atcaccagccttccgcaaggcgtaaaagttctccttacagcgcgggaaaacgtaaagcaa
acttatcgggaaagcttcggagaaatgacagccattcagctaagcggtcttgaccaaaca
gatgcccacgaattttttcaacaagaagtgcatcactgcttacaaacatgcaacctccca
cgtaaacgggaaaagctggagcagctgttacatctatcatctgacctgaaaaacgaattc
atttcagcgactgccggaaacccgaaagccatggcactcagcattgcctatatgtcagac
gatgacatccccgctcagcagctgattcatgagcttggaaaagcaggctactcactgctg
gaattgtttgaattcctctttggccgcacctgggatagatgcaatgaagatacgcgaaag
ctctggcagacgctttgctttttcagcaagccgcctgatgaaaaaagcctggcggcagca
gccggattagacgcccgccgttttcattacgctatggaacaaatgcggtcatatgcgctg
attcagccggaacgaagccaaggcaggacacaatacttagcgcaccaaaccgttgtcgct
tacggagaacagcacttgtccgaacagcacgaatatgaaaaagaagcccgcaatcgctgg
gcgcactattatattgattatgccgaaacccatttaaagcgggaacagcccaactctatc
tattggagctacctgctgggacggaacttagatcaaatgaaacaagaatggccaaacatc
ttaaaggtcatccaatgggcaagtgaaactgaacaaaaagaaatcctaatcgaactcatc
acccgcattagccattttctaagcagaatcaacctgcccctgcgaatcgaatacggacgc
aaagcggccgacgccgcccatcacttaggccaacacacacgagaagcgtacttccgaatc
gacacctcaggctgggcattgatggaagtcaatgatttagacggagcgcttcagcaaata
gaagccgggctgaagattcttgaacaatcagacgctcacgatgcctatgatctaaaggtt
tggggacatgcactcaaagcaaggctgtttttaaaagacgggcaacaggaaaaagcagag
acaattttaaacgaaatcgaaaatcaaccgatttcccctaccattcaacacagagttcta
ttggttcgcggtgacttaagctttgcgagaggttatcatgtagaagccattcaattatac
gaagcggcaaatgaaatcagctccacatacggcggcgaaaaaacgatagaagcctatttc
aatctgggtgtcgcttacgtgaaatgtgatcagtttgaaaaagcggaagaagcctttgag
caaatgctctatgacaaacataacgccaatcaagttgaactgatctactatcactacgga
atggcgcagctgttgtatcgtaaaggagagaaaacgaaagcggtggaatctaatcagaag
gcgattcgtttgattgattcgtgggagcctgcgattgggattcggggagaggttgaacga
ttagcaagggcaactaaagaaaacgagtag

DBGET integrated database retrieval system