KEGG   Bacillus subtilis subsp. subtilis 168: BSU06160
Entry
BSU06160          CDS       T00010                                 

Symbol
gutP
Name
(RefSeq) glucitol transport protein GutA
  KO
K16248  probable glucitol transport protein GutA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU06160 (gutP)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU06160 (gutP)
SSDB
Motif
Pfam: MFS_2 MFS_1
Other DBs
NCBI-GeneID: 936004
NCBI-ProteinID: NP_388497
Pasteur: BG12795
BSORF: BG12795
UniProt: O34368 A0A6M3ZJA7
Position
668601..669992
AA seq 463 aa
MIGTEKVTALKAKHQSKSSTGLSWFERIGYGFGDMSYNIIFQFVNAYLLFYYTDVGGIQP
AVIATLFLVVRVLDAIFDPIMGLILDKTNTRWGKARPYLLWVAFPFALFTFLCFTTPHFG
ETGNMVYAYVTYILLGMSFSMQTIPVNSLTGRMTNSVEERTVLTTTRMILVYIGILLSIS
CATPLATAIGGEDQAFGFQMTALIYAAVSIVLNLFSFFTVRERIQPKKRKKQGIKKTLSV
LFKNKPLLMLISSFLAFAIGFNIKLSTMVYYFTYNVNHKEFVFMGTVLFFGAALISNLFI
PFFSEKWGRKQVMIITAALSLISYAGLHFTPYSSIPLIFIWLFASGFFTTPLNTLAWGMV
ADCVDYAEWKTGIRADGVVISSMSFINKLGVALAGSFSAIYLGIAGYVANTDQTVASLNA
IKNMNALIPGFFILLSIILIAFYPLTEKRYKHIISELEQRSAR
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgattggaacagaaaaagtaacggcattgaaggcgaagcatcagtcaaaatccagcacc
ggcctgtcctggtttgaacgaatcggttatggattcggcgatatgtcgtataatattatc
tttcagtttgtaaacgcatacttattattttattatacagacgtcggcggcattcagcct
gcggtaatcgcaactttgtttcttgttgtgcgtgtgctggatgctatttttgacccgatc
atgggattgattttagataaaacgaatacaaggtggggaaaagcaaggccatatttgctg
tgggtggcatttccttttgcgctattcacattcttatgtttcacgacgcctcatttcggt
gagaccggaaatatggtatatgcgtatgtcacttatattctgcttgggatgtcctttagt
atgcaaacgatcccggtgaacagcttaacggggcggatgacgaattcggtggaggaacga
acggttctgaccacaacccggatgattttggtgtatatcggcattcttttatccatttcc
tgtgcgacaccgcttgcaactgctatcggaggagaggatcaggcgtttggatttcagatg
acggcgctcatctatgcggctgtcagcatcgttttgaatctatttagtttctttactgta
cgggagcggattcagcctaaaaagagaaaaaaacaagggatcaaaaagacgttatccgtt
ttattcaaaaacaaacccttgctcatgttaatttcatcatttttggcttttgcgatcggg
tttaatattaagctcagcacgatggtgtattattttacgtataacgtaaaccataaagag
ttcgtgtttatgggcaccgttttatttttcggggcagcgctgatcagcaatttgtttatt
cctttcttttctgagaagtggggcagaaaacaagtcatgattatcacggcagctctatcg
cttatttcttatgccggcctgcattttacgccgtattcttcaattccactcattttcatt
tggcttttcgcttcgggatttttcacaacgcctttaaatacgcttgcttggggaatggtt
gcggattgcgtcgattatgcggaatggaaaaccggaattcgcgcggatggtgttgtgatt
tcgagcatgagctttattaataagctgggtgttgcgttagccgggtcattttcggccatt
tatttaggaatcgccgggtatgtggcgaatacagaccagacagttgcgtcgttgaatgcg
attaaaaatatgaatgctttgattccgggatttttcattttgctttctattattcttatc
gccttctatcctttaacggaaaaaagatataaacacatcatctctgagctggagcaaagg
tctgcgagataa

DBGET integrated database retrieval system