KEGG   Bacillus subtilis subsp. subtilis 168: BSU06180
Entry
BSU06180          CDS       T00010                                 

Symbol
pspA
Name
(RefSeq) phage shock protein A homolog
  KO
K03969  phage shock protein A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99998 Others
    BSU06180 (pspA)
SSDB
Motif
Pfam: PspA_IM30 Sec34 LMBR1 Cluap1
Other DBs
NCBI-GeneID: 936013
NCBI-ProteinID: NP_388499
Pasteur: BG12797
BSORF: BG12797
UniProt: P54617 A0A6M3ZDA9
Position
671245..671928
AA seq 227 aa
MSIIGRFKDIMSANINALLDKAENPEKMVDQYLRNMNSDLAKVKAETAAVMAEEQRAKRE
YHECQADMEKMESYAMKALQAGNESDARKFLERKTSLESKLSELQAANQIAATNAAQMRK
MHDKLVSDIGELEARKNMIKAKWAVAKTQERMNKLGASVSSTSQSMSAFGRMEDKVNKAL
DQANAMAELNSAPQDDMADLSAKYDTGGSSQVDDELAALKAKMMLDK
NT seq 684 nt   +upstreamnt  +downstreamnt
atgagtataattggaagatttaaagatattatgtctgcgaatatcaatgctttattggac
aaggctgaaaatccggagaaaatggtagatcaatatttaagaaatatgaatagcgatttg
gctaaggttaaggcagaaacagcagctgttatggctgaggagcagagagcaaaaagagaa
tatcacgaatgccaggcggatatggaaaagatggaaagctatgcaatgaaggcgctgcaa
gccgggaatgagagcgatgcgagaaaatttcttgaaagaaaaacatctttggagtcaaag
ctttctgagctgcaggcggcgaatcaaattgctgcaaccaatgccgcacagatgagaaag
atgcatgacaaattggtatctgacattggagagctggaagcacgcaaaaatatgatcaag
gcgaagtgggcagtagcgaaaacgcaagaaagaatgaacaaactgggcgcttctgtttca
agtacaagccaatcaatgtctgcattcggccgaatggaggacaaagtaaataaggcactt
gatcaggccaatgcaatggctgaactgaacagcgctccgcaggatgatatggctgatctg
tctgcaaagtatgacactggcggttcaagccaggttgatgatgaacttgcggcgttaaaa
gcgaaaatgatgctcgataagtaa

DBGET integrated database retrieval system