KEGG   Bacillus subtilis subsp. subtilis 168: BSU06200
Entry
BSU06200          CDS       T00010                                 

Symbol
ydjH
Name
(RefSeq) hypothetical protein
  KO
K06872  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU06200 (ydjH)
SSDB
Motif
Pfam: TPM_phosphatase
Other DBs
NCBI-GeneID: 936015
NCBI-ProteinID: NP_388501
Pasteur: BG12799
BSORF: BG12799
UniProt: O35004 A0A6M3Z8H3
Position
673019..673783
AA seq 254 aa
MRGFFGKAIFVVLAVFIMMPLLGIEAVRASELQQHVYDRAHLLSKAEIGKLESLSAKLGA
KRDTDFIIITTKSTNGEDIADYTGDFYDRYGKGSTAILTIDMTNREVFIAGFKKAEQYLD
NSRLNSIRNTISSDLSNENYFEAFETYIQLSYKDMGIKPGVNPDNIFFTWWFQLIAAIAV
GGIAVSIMLYHAGGKVTVNGSTYMDQRTSDVIDQYDTYIRTTVTRERKPSDKDSGSDGGV
TKGGTSYSGSRGSF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcgtggattttttgggaaagcgatctttgttgtgctggctgttttcatcatgatgcct
ttactgggtatcgaagcggtaagagcctctgaattgcagcagcatgtgtacgatcgcgct
catctattgtcaaaagcggagatcggaaaacttgaatctctctcggcaaagctgggtgca
aagagggacactgatttcatcattattacgaccaaaagcacaaacggtgaagatattgca
gactataccggcgatttttatgatcgttacggaaaaggcagtacagccattctgacgatt
gatatgacaaacagagaagtgtttatcgcaggctttaaaaaagccgaacagtatttggac
aacagcaggctcaatagcatcagaaatacgatttcatctgatttatccaatgaaaattat
tttgaagcttttgagacatatattcagctttcctataaagatatgggcataaaaccggga
gtaaaccctgacaacatattctttacatggtggtttcagctgattgctgccatcgcagtc
gggggaattgcggtttcaatcatgctttatcatgcaggcggcaaagtaacggttaatgga
agtacatatatggatcagcgtacgtctgatgtgattgatcaatacgacacttatattaga
acgactgtaacaagagaaagaaaaccatcagataaagacagcggcagcgatggcggtgtt
acgaaaggcggcacgtcatacagtgggagccggggcagtttttaa

DBGET integrated database retrieval system