KEGG   Bacillus subtilis subsp. subtilis 168: BSU06210
Entry
BSU06210          CDS       T00010                                 

Symbol
ydjI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Band_7_1 Band_7 zf-ribbon_3 zinc_ribbon_2 DZR zinc_ribbon_15 zf-NADH-PPase zinc-ribbons_6 DZR_2 DUF1272
Other DBs
NCBI-GeneID: 939493
NCBI-ProteinID: NP_388502
Pasteur: BG12800
BSORF: BG12800
UniProt: O34789 A0A6M3Z820
Position
673814..674785
AA seq 323 aa
MSFFRNQLANVVEWEEFRDDMIFYKWNNREIKKGSRLIIRPGQDAVFLNNGRVEGVFQDD
GDYDIESEIIPFLSTLKGFKFGFNSGMRAEVLFVNTKEFTVRWGTKQAINIPAAGMPGGM
PIRANGTFNFKVQDYISLIDKIAGVKDQYFVEDIKTRIISILDQLLMKWITREGKDMFNL
QANAFDIAKGIQEDLDMQLISDGMTVTGFQIMSFNYPQEVQDMITKNASYGMVGDVNRYQ
QISMTDGMASGKMSGSGAASDMAGMMMGMNMANQMMNQMNQNQQAQSSGPQSTGSGSKPN
FCPNCGTKTGEANFCPNCGQKLV
NT seq 972 nt   +upstreamnt  +downstreamnt
atgtcgtttttcagaaatcaattagcgaatgtagtagagtgggaagaatttagagatgat
atgattttttataaatggaacaatcgtgaaatcaaaaaagggagccgtttaatcattcgt
cccggacaggatgctgtctttttgaacaatgggcgggttgaaggagtctttcaagatgat
ggcgattatgatattgaatcagaaattattccattcctttcaacgttaaagggctttaag
tttggctttaacagcggcatgcgagctgaggtgctgtttgtcaatacgaaggaatttacc
gtaagatggggaacaaaacaggcgataaatattccggcagcgggaatgccaggcgggatg
cccattcgcgcaaacggcacatttaatttcaaggtgcaggactatatcagcctgattgat
aaaatcgctggcgtgaaagatcaatattttgtagaggatattaaaacccgtatcatttct
attctggatcagcttctcatgaagtggatcacaagagaagggaaagatatgtttaatctt
caagcaaacgcttttgatattgccaagggaattcaagaggacttagatatgcaattaata
agcgacgggatgacggtcactggttttcaaatcatgagctttaattatcctcaagaggtt
caagatatgattacaaagaacgcttcctacggtatggttggggatgtgaacagataccag
caaatatcaatgacggatggaatggcatccggaaagatgagcggaagcggagcggcttcg
gatatggctggaatgatgatgggaatgaatatggccaatcagatgatgaaccaaatgaat
cagaatcagcaggcacagtcatcaggcccacagtcaactggcagcggaagcaaaccgaat
ttctgtccaaactgcggaacaaaaacgggcgaagccaatttttgtccgaattgcggccag
aagcttgtataa

DBGET integrated database retrieval system