KEGG   Bacillus subtilis subsp. subtilis 168: BSU06220Help
Entry
BSU06220          CDS       T00010                                 

Gene name
ydjJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 936027
NCBI-ProteinID: NP_388503
Pasteur: BG12801
BSORF: BG12801
UniProt: O34733
Position
complement(674832..675857)
Genome map
AA seq 341 aa AA seqDB search
MNEGYIIAGLLLLTAGMIDFLWTTLWLESGAGPITRCLSAWLWKGCRKISGDHAKVLSMA
GPLLLCLTLVIWISLFWSGWVLIYSSDPHSLMETQSKEPASWSDRIYFSGYVMFTLGNGD
LAPNGGLWKLVTIIETAQGLLTITFSVTYLISVLSAVNQKRSFAQSVLSLGHDGTEIVHN
AWNGKDFHDIDFLLVAASSELGKLTAQHNAFPILHFYHSTQHQESSIIAVAVLDEALTIF
KYGIPEQYQPNQLHIKEARSSIKNYLDTVHTAYIHPAEQAPPEPDISKLQQSGIPALSKQ
TFQIAVNSIKERRQLLLGIIQAGARKWPVQEQAIGNAYSPK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagggttatatcattgcaggccttttattattgacagcggggatgattgatttt
ttatggaccacgttatggttagagagcggtgccggcccgatcacaagatgcctgtctgcc
tggctgtggaagggctgccgcaaaatcagcggtgaccacgcaaaggttctaagtatggct
ggtcctctgctgttatgcctgacgttagtgatatggatcagtctattttggagcgggtgg
gttttgatttactcgagtgaccctcactcacttatggaaactcaatcaaaagaaccggct
tcctggtcagaccgaatttatttttccggctatgtcatgtttacattaggaaatggcgac
ctcgctccgaacggaggcctatggaagcttgtcacgattattgaaacagctcaaggactg
cttaccatcacattttctgtcacgtatttgatttccgtcttgagtgcggttaatcaaaaa
cgctcctttgcccaaagtgtattaagtctagggcatgacggaactgaaatcgtccataat
gcatggaatggcaaagattttcacgacattgattttcttcttgtcgctgcctcatcagaa
ctgggaaagctgaccgctcagcataacgccttccccatccttcatttttaccacagcacg
cagcatcaggaatcatccattatagctgttgctgtattggatgaggctctaaccattttc
aaatacggaattcctgaacaatatcagccgaatcagcttcatatcaaagaagcgcgctca
agtatcaaaaactatctggataccgttcatactgcctatatccatcctgcagaacaagcg
ccgccagaaccagacatctcaaagcttcaacaatcaggcataccggctttatcaaagcaa
acatttcaaattgccgtcaattcaataaaggaacgtcgtcaattgctgctgggaattatc
caagcgggggctcgaaaatggcctgttcaggagcaagcaataggtaatgcttattctcct
aaataa

DBGET integrated database retrieval system