KEGG   Bacillus subtilis subsp. subtilis 168: BSU06220
Entry
BSU06220          CDS       T00010                                 

Symbol
ydjJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Ion_trans_2
Other DBs
NCBI-GeneID: 936027
NCBI-ProteinID: NP_388503
Pasteur: BG12801
BSORF: BG12801
UniProt: O34733 A0A6M3Z7Z4
Position
complement(674832..675857)
AA seq 341 aa
MNEGYIIAGLLLLTAGMIDFLWTTLWLESGAGPITRCLSAWLWKGCRKISGDHAKVLSMA
GPLLLCLTLVIWISLFWSGWVLIYSSDPHSLMETQSKEPASWSDRIYFSGYVMFTLGNGD
LAPNGGLWKLVTIIETAQGLLTITFSVTYLISVLSAVNQKRSFAQSVLSLGHDGTEIVHN
AWNGKDFHDIDFLLVAASSELGKLTAQHNAFPILHFYHSTQHQESSIIAVAVLDEALTIF
KYGIPEQYQPNQLHIKEARSSIKNYLDTVHTAYIHPAEQAPPEPDISKLQQSGIPALSKQ
TFQIAVNSIKERRQLLLGIIQAGARKWPVQEQAIGNAYSPK
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaatgagggttatatcattgcaggccttttattattgacagcggggatgattgatttt
ttatggaccacgttatggttagagagcggtgccggcccgatcacaagatgcctgtctgcc
tggctgtggaagggctgccgcaaaatcagcggtgaccacgcaaaggttctaagtatggct
ggtcctctgctgttatgcctgacgttagtgatatggatcagtctattttggagcgggtgg
gttttgatttactcgagtgaccctcactcacttatggaaactcaatcaaaagaaccggct
tcctggtcagaccgaatttatttttccggctatgtcatgtttacattaggaaatggcgac
ctcgctccgaacggaggcctatggaagcttgtcacgattattgaaacagctcaaggactg
cttaccatcacattttctgtcacgtatttgatttccgtcttgagtgcggttaatcaaaaa
cgctcctttgcccaaagtgtattaagtctagggcatgacggaactgaaatcgtccataat
gcatggaatggcaaagattttcacgacattgattttcttcttgtcgctgcctcatcagaa
ctgggaaagctgaccgctcagcataacgccttccccatccttcatttttaccacagcacg
cagcatcaggaatcatccattatagctgttgctgtattggatgaggctctaaccattttc
aaatacggaattcctgaacaatatcagccgaatcagcttcatatcaaagaagcgcgctca
agtatcaaaaactatctggataccgttcatactgcctatatccatcctgcagaacaagcg
ccgccagaaccagacatctcaaagcttcaacaatcaggcataccggctttatcaaagcaa
acatttcaaattgccgtcaattcaataaaggaacgtcgtcaattgctgctgggaattatc
caagcgggggctcgaaaatggcctgttcaggagcaagcaataggtaatgcttattctcct
aaataa

DBGET integrated database retrieval system