KEGG   Bacillus subtilis subsp. subtilis 168: BSU06230
Entry
BSU06230          CDS       T00010                                 

Gene name
iolT
Definition
(RefSeq) major myo-inositol transporter IolT
  KO
K06609  MFS transporter, SP family, major inositol transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU06230 (iolT)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    BSU06230 (iolT)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 936014
NCBI-ProteinID: NP_388504
Pasteur: BG12802
BSORF: BG12802
UniProt: O34718 A0A6M3Z836
Position
676442..677863
AA seq 473 aa
MNKQGNQMSFLRTIILVSTFGGLLFGYDTGVLNGALPYMGEPDQLNLNAFTEGLVTSSLL
FGAALGAVFGGRMSDFNGRRKNILFLAVIFFISTIGCTFAPNVTVMIISRFVLGIAVGGA
SVTVPAYLAEMSPVESRGRMVTQNELMIVSGQLLAFVFNAILGTTMGDNSHVWRFMLVIA
SLPALFLFFGMIRMPESPRWLVSKGRKEDALRVLKKIRDEKRAAAELQEIEFAFKKEDQL
EKATFKDLSVPWVRRIVFIGLGIAIVQQITGVNSIMYYGTEILRNSGFQTEAALIGNIAN
GVISVLATFVGIWLLGRVGRRPMLMTGLIGTTTALLLIGIFSLVLEGSPALPYVVLSLTV
TFLAFQQGAISPVTWLMLSEIFPLRLRGLGMGVTVFCLWMVNFAVSFTFPILLAAIGLST
TFFIFVGLGICSVLFVKRFLPETKGLSLEQLEENFRAYDHSGAKKDSGAEVIG
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaataaacaaggaaatcaaatgtcatttttacgtacaattattttagtctccactttc
ggcgggcttctttttggctatgataccggtgtgctcaatggagctttgccgtatatggga
gagccggatcagcttaatctcaatgccttcacagaaggccttgtcaccagttcacttctt
tttggagcggcactgggtgctgtgtttggcggcaggatgtctgattttaacggccgccgc
aaaaatattttgttcctcgctgttatattttttatttcaacgattgggtgtacgtttgca
ccaaatgttacggtcatgattatttcccgttttgtgctcggtattgcggttgggggtgca
tccgtaacggtgcctgcctatttagcagagatgtctcctgtggaaagcaggggacggatg
gtgacgcagaacgaattgatgattgtatcaggacagcttttggcctttgtttttaatgcg
atccttggaacaacaatgggagacaactcccatgtgtggaggtttatgctggtcattgcg
tcacttccagccttgttcctgtttttcggcatgatcagaatgcccgagagtccccgttgg
cttgtttctaaaggaagaaaagaagatgctttgcgtgtattgaaaaaaatcagggacgaa
aaacgggcagcagctgagctgcaagaaattgaattcgctttcaaaaaagaagaccagctt
gaaaaagcgacatttaaagatctttcagtcccatgggtgcgccgtattgtgtttattgga
ttagggattgcgattgtacagcaaattacaggtgtgaattcgattatgtattatgggact
gaaattctaagaaattccggtttccaaacggaagccgctttaatcggaaatattgcgaat
ggcgtgatttcggtattggcaacattcgtcggaatctggctgctgggaagagtggggcgc
cggccgatgctgatgacaggcttgatcggtacgacaacagcattattgctaatcgggata
ttctcacttgtacttgaaggatcaccggcacttccgtatgtagtcctgtcattaacggtc
acatttcttgcttttcagcagggcgccatttcaccagtgacttggctgatgctatctgaa
attttcccgcttcgccttcgcggactgggaatgggtgttacggtattctgtctgtggatg
gtgaattttgcagtcagtttcacgtttccgatattgctggcagctatcgggctgtccaca
acgttctttatcttcgttggattaggaatttgctctgtcttgtttgtgaagaggtttttg
ccggaaacgaaagggctttcgcttgagcagctggaggaaaacttccgcgcttatgatcac
agcggggcaaagaaggattctggggctgaagtgattggataa

DBGET integrated database retrieval system