KEGG   Bacillus subtilis subsp. subtilis 168: BSU06250
Entry
BSU06250          CDS       T00010                                 

Symbol
ydjM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DPBB_1
Other DBs
NCBI-GeneID: 936017
NCBI-ProteinID: NP_388506
Pasteur: BG11036
BSORF: BG11036
UniProt: P40775 A0A6M3Z808
Position
679390..679761
AA seq 123 aa
MLKKVILAAFILVGSTLGAFSFSSDASAKHVNGNITWYNGVGKKGSSGKKLGHWDCATKI
GFDVPRNGTKIRAYAKAKPKKVITVYKNDVGRMPNAVLDVSPKAFKALGYPLSKGKVAGH
YSY
NT seq 372 nt   +upstreamnt  +downstreamnt
atgttgaagaaagtcattttagccgcttttatcttagtaggaagtactttgggagctttt
agtttttcatcagatgccagtgcgaaacatgtgaacggaaatattacttggtataatgga
gtcgggaaaaaaggctcttcaggtaagaaacttggacattgggattgtgcgaccaaaatc
ggatttgatgttcctagaaacgggacaaaaatcagagcttatgcaaaagcgaagcctaaa
aaggtgattacggtttataaaaatgatgttggcagaatgcctaatgcagtgctggatgtt
agccctaaagcgtttaaagcgcttggatacccattaagcaaaggtaaagtagcggggcat
tacagctattaa

DBGET integrated database retrieval system