KEGG   Bacillus subtilis subsp. subtilis 168: BSU06260
Entry
BSU06260          CDS       T00010                                 

Symbol
ydjN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PD40 DUF1616 Wzz Pilin_N DUF5074
Other DBs
NCBI-GeneID: 939488
NCBI-ProteinID: NP_388507
Pasteur: BG12804
BSORF: BG12804
UniProt: O34353 A0A6M4JDK1
Position
679827..680873
AA seq 348 aa
MKKRIILLLAVIIAAAAAGVAFYVAKDKGHEKAADVSVNTESGDELLVSITDTDLLTKYY
ENDKVIHEEKLTSYPAFALDQKQQVLYYTGNNEQNEMRLFKLDLKSHKKTMLYKGAESAD
SLFLSKDRSTIYFRLGKADESNFRIAAFDLKTKKYKNLYPAANDQDDTVSSFFYNQKNDS
FALLHYSVEEDYKKTDEANEKGIDPEPTTIHFAEGRQNKFNELKSLNQFISDIAVSDDDK
RILFTSYTQKGTEQTASIQMLNADTKKYESIISNQKSFKLLIDAQPQFSKDGKNIYFLAE
AKGAKKLKDETGREAKVRTIYSYSLENKTFKKVWENPNGIINSFFVIN
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgaaaaaaagaatcatattattattagcagtgataatagcggcagctgccgcgggggtt
gcgttttatgttgcaaaggataaaggccatgagaaggctgctgatgtttcagtcaatacc
gaaagcggtgatgagctgctggtttcaattacagatacggatctgctgacaaagtattat
gaaaatgacaaggtgatccatgaggagaagctgaccagctatccggcatttgccttggat
caaaaacagcaggtgctctattatacgggcaataatgaacagaatgaaatgaggcttttt
aaattggatctgaagtctcataaaaaaacgatgctttataaaggcgcggagagtgcggac
agtttatttttatcaaaggaccgttcaaccatctatttccgcttaggaaaagcggacgaa
agcaattttcgaatcgccgcttttgatctgaagacgaaaaagtataaaaatctttatcct
gccgctaatgatcaggatgacaccgtcagcagcttcttttataaccaaaaaaacgattca
tttgcattgcttcattattctgtagaagaagactacaagaaaacagatgaagcaaacgaa
aagggcatcgaccctgaaccgacaacgattcattttgcggaaggccgccaaaataaattt
aatgagctgaaaagcctgaaccaatttatcagcgatattgctgtttctgatgatgataaa
cgtattttattcacatcatatacgcaaaaaggaacggagcaaaccgcttctattcaaatg
ctcaatgcggatacgaaaaaatatgaaagcatcatctcaaatcaaaaatcatttaagctg
ttaattgacgcacagcctcagttttctaaggatgggaagaacatttattttcttgccgaa
gccaagggggctaaaaagctgaaggacgaaacagggcgtgaagctaaggtgcggacgatt
tattcctatagccttgagaataagaccttcaaaaaagtatgggaaaatccgaacggcatc
atcaacagcttttttgtgattaactaa

DBGET integrated database retrieval system