KEGG   Bacillus subtilis subsp. subtilis 168: BSU06269
Entry
BSU06269          CDS       T00010                                 

Symbol
ydzJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303125
NCBI-ProteinID: YP_003097689
UniProt: O24817 A0A6M3Z8E5
Position
complement(680907..681065)
AA seq 52 aa
MISNQQQKDLKKRAAFKKLNVAMNSYVELLFLSVPLIHIFKWLGSLALHLIH
NT seq 159 nt   +upstreamnt  +downstreamnt
gtgatctcaaaccagcagcaaaaagacttgaaaaaaagagctgcgttcaaaaagctgaat
gttgcaatgaactcatatgttgaacttctgtttttgtcggtacctctgattcatatcttt
aaatggctcggatcattagccctgcacctcatccattaa

DBGET integrated database retrieval system