KEGG   Bacillus subtilis subsp. subtilis 168: BSU06280Help
Entry
BSU06280          CDS       T00010                                 

Gene name
ydjP
Definition
(RefSeq) AB hydrolase superfamily protein YdjP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Thioesterase FSH1
Motif
Other DBs
NCBI-GeneID: 936035
NCBI-ProteinID: NP_388509
Pasteur: BG12806
BSORF: BG12806
UniProt: O34592
Position
complement(681547..682362)
Genome map
AA seq 271 aa AA seqDB search
MPYIILEDQTRLYYETHGSGTPILFIHGVLMSGQFFHKQFSVLSANYQCIRLDLRGHGES
DKVLHGHTISQYARDIREFLNAMELDHVVLAGWSMGAFVVWDYLNQFGNDNIQAAVIIDQ
SASDYQWEGWEHGPFDFDGLKTAMHAIQTDPLPFYESFIQNMFAEPPAETETEWMLAEIL
KQPAAISSTILFNQTAADYRGTLQNINVPALLCFGEDKKFFSTAAGEHLRSNIPNATLVT
FPKSSHCPFLEEPDAFNSTLLSFLDGVIGKS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgccatacatcatattagaagatcagacacgcctttactatgaaacacacgggagcggg
acgccgatcctgtttatacatggggtgctgatgagcggacaatttttccacaaacaattt
tcggtgctttctgccaattatcaatgtattcgtcttgatcttagaggacacggcgaatct
gacaaagtgcttcacggccacaccatttcccaatatgcccgtgacataagggaatttcta
aatgcaatggagcttgatcatgtcgttcttgccggctggtcaatgggtgcttttgtcgta
tgggattatctcaatcagtttgggaatgataacattcaagccgctgtgatcatcgatcaa
tccgcttcggactatcaatgggagggctgggaacatggtccatttgattttgacggctta
aaaacagcgatgcacgccattcaaactgacccgctgcctttctacgaaagcttcatccag
aatatgttcgcagaaccgcctgccgagaccgaaacagaatggatgctggcagaaatcctc
aaacagccggctgccatttctagcacgattttatttaaccaaacggccgctgattaccgg
ggcaccctccaaaacatcaatgtgccggcattgctgtgcttcggggaagacaagaaattt
ttctctacagcagctggggaacacttgcgcagcaatattccaaacgcgacactcgttacc
tttcctaaaagcagccattgcccgtttttagaagagccagatgcttttaacagcacactc
ctctcctttttagatggggttattggaaagtcataa

DBGET integrated database retrieval system