KEGG   Bacillus subtilis subsp. subtilis 168: BSU06290Help
Entry
BSU06290          CDS       T00010                                 

Gene name
yeaA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4003 PPR_2
Motif
Other DBs
NCBI-GeneID: 936018
NCBI-ProteinID: NP_388510
Pasteur: BG12210
BSORF: BG12210
UniProt: O34803
Position
complement(682375..683364)
Genome map
AA seq 329 aa AA seqDB search
MLTHDLHEKTKHYISIYAELKTKLKWKVSHDQILMLISSAYIVNKREFDFQRFYDLSSYI
KSNIGSFSTLNSHHRFTVASILDIHFQHEAKQTFQTFIDVYNEMVKLGYKRDMFTYLSAL
ILLTGKSETTNQKEQMNMGLAVYQQMKKNHYFLTSTQNVPLAVLLGENGKGLQALQKAET
CYQLLAANGFKKGQYLHQVSHILALQSEKEPEMLVSACKQIYQSITESVKKTKDYHYPDL
ALLTFLEEPDIKTVLCITDELNQEKAFKWQKEMNFKIAVSLYLSEHMEKNLLMESGLYTA
IETVIQAQQAAATAAIISSTAASHTHDGN
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgctcacacacgatctacatgaaaaaacaaagcattacatttccatttatgctgaatta
aaaacaaaattaaaatggaaagtttcacacgatcagatattaatgctcatttcttctgca
tatattgtgaataaaagagagtttgattttcagcgcttttatgatttgagcagctatatc
aaatcaaacatcggcagcttctcaacactcaattcacaccaccgctttactgttgcatct
attctggacattcattttcagcatgaggcaaaacaaacatttcagactttcatcgatgta
tacaatgaaatggtgaagctagggtataagcgggatatgttcacatacctttccgctctg
atcttgctcaccggcaaatctgaaacgacaaaccaaaaagaacagatgaacatggggcta
gctgtttatcagcagatgaagaaaaatcattatttcctcacttcaactcagaatgttccg
cttgccgtactgcttggagaaaacggaaaaggtttgcaggcgctacagaaggcggaaaca
tgctatcaactgctggcagccaacggctttaaaaaaggacagtacttacatcaggtcagc
catattctggccttgcaaagtgaaaaagagcccgaaatgcttgtttccgcttgcaaacag
atatatcaatcgatcactgaatctgtcaaaaaaacaaaggattatcattatccagacctt
gctctcctcacatttctggaagagccagatatcaaaaccgttttgtgcatcactgacgaa
ttaaaccaggaaaaagcttttaaatggcaaaaggaaatgaactttaaaattgctgtcagc
ctctatctcagtgagcatatggagaaaaatctgctgatggaatcaggactatacaccgct
atcgaaacagtcattcaagcgcagcaggcagccgcgacagctgccatcatcagctcaaca
gcagccagccatactcatgatggaaactaa

DBGET integrated database retrieval system