KEGG   Bacillus subtilis subsp. subtilis 168: BSU06290
Entry
BSU06290          CDS       T00010                                 

Symbol
yeaA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4003 PPR_2
Other DBs
NCBI-GeneID: 936018
NCBI-ProteinID: NP_388510
Pasteur: BG12210
BSORF: BG12210
UniProt: O34803 A0A6M4JFZ9
Position
complement(682375..683364)
AA seq 329 aa
MLTHDLHEKTKHYISIYAELKTKLKWKVSHDQILMLISSAYIVNKREFDFQRFYDLSSYI
KSNIGSFSTLNSHHRFTVASILDIHFQHEAKQTFQTFIDVYNEMVKLGYKRDMFTYLSAL
ILLTGKSETTNQKEQMNMGLAVYQQMKKNHYFLTSTQNVPLAVLLGENGKGLQALQKAET
CYQLLAANGFKKGQYLHQVSHILALQSEKEPEMLVSACKQIYQSITESVKKTKDYHYPDL
ALLTFLEEPDIKTVLCITDELNQEKAFKWQKEMNFKIAVSLYLSEHMEKNLLMESGLYTA
IETVIQAQQAAATAAIISSTAASHTHDGN
NT seq 990 nt   +upstreamnt  +downstreamnt
atgctcacacacgatctacatgaaaaaacaaagcattacatttccatttatgctgaatta
aaaacaaaattaaaatggaaagtttcacacgatcagatattaatgctcatttcttctgca
tatattgtgaataaaagagagtttgattttcagcgcttttatgatttgagcagctatatc
aaatcaaacatcggcagcttctcaacactcaattcacaccaccgctttactgttgcatct
attctggacattcattttcagcatgaggcaaaacaaacatttcagactttcatcgatgta
tacaatgaaatggtgaagctagggtataagcgggatatgttcacatacctttccgctctg
atcttgctcaccggcaaatctgaaacgacaaaccaaaaagaacagatgaacatggggcta
gctgtttatcagcagatgaagaaaaatcattatttcctcacttcaactcagaatgttccg
cttgccgtactgcttggagaaaacggaaaaggtttgcaggcgctacagaaggcggaaaca
tgctatcaactgctggcagccaacggctttaaaaaaggacagtacttacatcaggtcagc
catattctggccttgcaaagtgaaaaagagcccgaaatgcttgtttccgcttgcaaacag
atatatcaatcgatcactgaatctgtcaaaaaaacaaaggattatcattatccagacctt
gctctcctcacatttctggaagagccagatatcaaaaccgttttgtgcatcactgacgaa
ttaaaccaggaaaaagcttttaaatggcaaaaggaaatgaactttaaaattgctgtcagc
ctctatctcagtgagcatatggagaaaaatctgctgatggaatcaggactatacaccgct
atcgaaacagtcattcaagcgcagcaggcagccgcgacagctgccatcatcagctcaaca
gcagccagccatactcatgatggaaactaa

DBGET integrated database retrieval system