KEGG   Bacillus subtilis subsp. subtilis 168: BSU06300
Entry
BSU06300          CDS       T00010                                 

Symbol
cotA
Name
(RefSeq) spore coat protein A
  KO
K06324  spore coat protein A, manganese oxidase [EC:1.16.3.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU06300 (cotA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.3  manganese oxidase
     BSU06300 (cotA)
SSDB
Motif
Pfam: Cu-oxidase_2 Cu-oxidase_3 Cu-oxidase
Other DBs
NCBI-GeneID: 936023
NCBI-ProteinID: NP_388511
Pasteur: BG10490
BSORF: BG10490
UniProt: P07788 A0A6M4JFQ2
Structure
Position
complement(683462..685003)
AA seq 513 aa
MTLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTI
EVKRNENVYVKWMNNLPSTHFLPIDHTIHHSDSQHEEPEVKTVVHLHGGVTPDDSDGYPE
AWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEK
RLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVW
PYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERY
DIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPS
VQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHP
IHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAAT
FGPYSGRYVWHCHILEHEDYDMMRPMDITDPHK
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgacacttgaaaaatttgtggatgctctcccaatcccagatacactaaagccagtacag
caatcaaaagaaaaaacatactacgaagtcaccatggaggaatgcactcatcagctccat
cgcgatctccctccaacccgcctgtggggctacaacggcttatttccgggaccgaccatt
gaggttaaaagaaatgaaaacgtatatgtaaaatggatgaataaccttccttccacgcat
ttccttccgattgatcacaccattcatcacagtgacagccagcatgaagagcccgaggta
aagactgttgttcatttacacggcggcgtcacgccagatgatagtgacgggtatccggag
gcttggttttccaaagactttgaacaaacaggaccttatttcaaaagagaggtttatcat
tatccaaaccagcagcgcggggctatattgtggtatcacgatcacgccatggcgctcacc
aggctaaatgtctatgccggacttgtcggtgcatatatcattcatgacccaaaggaaaaa
cgcttaaaactgccttcagacgaatacgatgtgccgcttcttatcacagaccgcacgatc
aatgaggatggttctttgttttatccgagcgcaccggaaaacccttctccgtcactgcct
aatccttcaatcgttccggctttttgcggagaaaccatactcgtcaacgggaaggtatgg
ccatacttggaagtcgagccaaggaaataccgattccgtgtcatcaacgcctccaataca
agaacctataacctgtcactcgataatggcggagattttattcagattggttcagatgga
gggctcctgccgcgatctgttaaactgaattctttcagccttgcgcctgctgaacgttac
gatatcatcattgacttcacagcatatgaaggagaatcgatcattttggcaaacagcgcg
ggctgcggcggtgacgtcaatcctgaaacagatgcgaatatcatgcaattcagagtcaca
aaaccattggcacaaaaagacgaaagcagaaagccgaagtacctcgcctcatacccttcg
gtacagcatgaaagaatacaaaacatcagaacgttaaaactggcaggcacccaggacgaa
tacggcagacccgtccttctgcttaataacaaacgctggcacgatcccgtcacagaaaca
ccaaaagtcggcacaactgaaatatggtccattatcaacccgacacgcggaacacatccg
atccacctgcatctagtctccttccgtgtattagaccggcggccgtttgatatcgcccgt
tatcaagaaagcggggaattgtcctataccggtccggctgtcccgccgccgccaagtgaa
aagggctggaaagacaccattcaagcgcatgcaggtgaagtcctgagaatcgcggcgaca
ttcggtccgtacagcggacgatacgtatggcattgccatattctagagcatgaagactat
gacatgatgagaccgatggatataactgatccccataaataa

DBGET integrated database retrieval system