KEGG   Bacillus subtilis subsp. subtilis 168: BSU06319
Entry
BSU06319          CDS       T00010                                 

Symbol
ydzX
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303160
NCBI-ProteinID: YP_003097690
UniProt: C0H3X2 A0A6M3Z847
Position
complement(686602..686889)
AA seq 95 aa
MIHPPQKNSDEGTLFLSSNLFAPPKIPSNPRTPVLLAFYRIVNITQNHTANKKRNIFSTH
SLKAQTKHYKFEISWYIFLHEFSTNCIFMIEFQLS
NT seq 288 nt   +upstreamnt  +downstreamnt
atgattcacccgccacagaaaaatagtgacgaaggaacactttttctctcatccaattta
tttgctccgccaaaaatcccatcaaacccaaggacaccagtgcttctcgcattctatcga
attgtaaatattacgcaaaatcacacagcgaataaaaaacgaaacattttttccacacat
tcgctgaaagcgcaaacaaaacactacaaatttgaaataagctggtatattttcttacac
gaattttcgacaaactgtatatttatgatagagtttcaattatcataa

DBGET integrated database retrieval system