KEGG   Bacillus subtilis subsp. subtilis 168: BSU06320
Entry
BSU06320          CDS       T00010                                 

Symbol
yeaB
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Cation_efflux ZT_dimer CbiM Spore_GerAC SPC12 INSIG
Other DBs
NCBI-GeneID: 936032
NCBI-ProteinID: NP_388513
Pasteur: BG11329
BSORF: BG11329
UniProt: P46348 A0A6M4JKR7
Position
686962..687834
AA seq 290 aa
MERYDELKKGESGALVSIAAYLVLSAIKLIIGYLFHSEALTADGLNNTTDIIASVAVLIG
LRISQKPPDEDHPYGHFRAETIASLIASFIMMVVGLQVLFSAGESIFSAKQETPDMIAAW
TAAGGAVLMLIVYRYNKRLAKKVKSQALLAAAADNKSDAFVSIGTFIGIVAAQFHLAWID
TVTAFVIGLLICKTAWDIFKESSHSLTDGFDIKDISAYKQTIEKISGVSRLKDIKARYLG
STVHVDVVVEVSADLNITESHDIANEIERRMKEEHAIDYSHVHMEPLEQK
NT seq 873 nt   +upstreamnt  +downstreamnt
atggagagatatgatgaactgaaaaagggagaatccggagcgctggtcagcattgccgcg
tatctagttctttccgcaattaaactgatcatcggttatctttttcactcggaagcactt
acggcagacgggttaaataacacaactgacattattgcttctgttgctgtgctgattggc
ctgcgcatctctcaaaagcctcctgacgaagatcatccatacggccactttcgagcggaa
acgattgcatcgcttatcgcatcgtttattatgatggttgtcggactgcaagtgctgttc
agcgccggagaatctattttttctgctaaacaagagacgccagatatgattgcggcttgg
acggcagcgggcggggcagtcctgatgctgatcgtttaccggtacaataaaaggctggcc
aaaaaggtgaagagccaggcgctccttgctgcggctgctgataataaatcagacgcattc
gtcagtatcggcacatttatcggcattgtggctgctcaattccatcttgcttggattgat
acggtcactgcgtttgtgatcggtctgcttatttgcaagaccgcatgggatatctttaaa
gagtcatctcactctttgacagatggattcgacataaaggacatttccgcttataaacag
acaatcgaaaaaatctccggtgtgagccgtttaaaagacataaaagcaagatacttgggc
agtacggttcatgttgatgtggtggttgaggtatcggcagatttaaatattacggaaagc
cacgatatagccaatgaaattgagcggagaatgaaggaggagcatgcgattgattattcg
catgttcatatggagcctttagaacaaaaataa

DBGET integrated database retrieval system