KEGG   Bacillus subtilis subsp. subtilis 168: BSU06330
Entry
BSU06330          CDS       T00010                                 

Symbol
yeaC
Name
(RefSeq) hypothetical protein
  KO
K03924  MoxR-like ATPase [EC:3.6.3.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU06330 (yeaC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Catalysing transmembrane movement of substances
    3.6.3.-  
     BSU06330 (yeaC)
SSDB
Motif
Pfam: AAA_3 AAA_lid_2 AAA_5 bpMoxR AAA MCM RuvB_N Sigma54_activat AAA_2 Mg_chelatase AAA_16 AAA_30
Other DBs
NCBI-GeneID: 939484
NCBI-ProteinID: NP_388514
Pasteur: BG12211
BSORF: BG12211
UniProt: P94474 A0A6M4JJ59
Position
688184..689146
AA seq 320 aa
MAYQEDLHPLLGKAVEHINRVMVGKRDIAILSLAALLAKGHVLLEDVPGVGKTMMVRALA
KSIGADFKRIQFTPDLLPSDVTGVSIYNAKTMEFEYRPGPIMGNIVLADEINRTSPKTQS
ALLEAMEEGSVTVDGHTMQLADPFFVMATQNPVEYEGTYPLPEAQLDRFLFKLRMGYPSF
NEELDVLSLQEKSHPIETLEPVIAKEDFIFLQREVQNVRADDSIKEYIVEIVQKTRQHPS
VQLGVSPRGSIALMKAAQAYALLHHRDYVIPDDIQYLAPFTLPHRMMLHPEAKFEGIQAE
AIVREIMSAVKVPVQRSAVR
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcatatcaagaagacctgcatcctttgctggggaaagcagttgaacatattaataga
gtaatggttggaaaacgagacatcgccatactcagcttagcagcccttcttgccaaaggg
catgtgctgcttgaggatgtacccggagtcggaaaaacgatgatggtccgcgcgctggca
aagtcaatcggcgccgatttcaaaagaatccaattcactccggatttgctgccatctgat
gtaacaggggtatctatctataatgcgaaaacgatggaatttgaatatcgtcccggccca
attatgggaaatatcgtgctggcagatgaaatcaaccgtacctctccgaagacacagtcg
gctttgctcgaagcgatggaagaggggagcgtcacggtagatggccatacgatgcagctt
gccgatccgttttttgtgatggcaacgcaaaacccggtcgaatatgaagggacctatcct
ttgccggaagctcagcttgaccgttttttattcaaacttcggatgggttatccgtccttt
aatgaagagcttgacgtcttatctcttcaggaaaaaagccatccgattgagacgcttgag
ccggttattgcaaaagaagacttcatctttttacagagggaagtgcaaaatgtccgtgct
gatgacagcattaaggaatatatcgttgaaattgtgcagaaaacgagacagcatccttct
gttcaattaggcgtcagtccgcgcggctcaatcgccctcatgaaagcggcacaggcatac
gcgctgctgcatcatcgcgactatgtcataccggatgatattcaatatttagctcctttc
acgctgccgcaccggatgatgcttcatcctgaggcaaaatttgaagggattcaggcagaa
gcgatcgtaagggagatcatgtcagctgtgaaggtgccggttcaaaggtcggcggtccgc
tga

DBGET integrated database retrieval system