KEGG   Bacillus subtilis subsp. subtilis 168: BSU06340
Entry
BSU06340          CDS       T00010                                 

Symbol
yeaD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF58 bMG10 FAM76 DUF520
Other DBs
NCBI-GeneID: 939486
NCBI-ProteinID: NP_388515
Pasteur: BG12212
BSORF: BG12212
UniProt: P94475 A0A6M4JDL6
Position
689146..690342
AA seq 398 aa
MNKKWQWLVYGWKLIILTLLTAAVFSYAMFQGGFVSWFLFYAFLPFVLYAGLLALYPLRS
FQASRQMDKTQLHAGDRLGVTVTLRRKLPFPLMYMVIEDCLPEGIESLNRDGAAAKRLVF
PWFKRSMTMSYELARVPRGEHHFHSVRVRTGDVLGLIEKTAFFELDDTLFVYPFYQRFSY
QVNERHQEDGVSGSSPIHQHHSSVAASVRNYQPGDRFAALDWKTSARRSQLMTKEFEPSR
SKNLFLLMDRFSSDAFEEVVSVTASILHSVLKNGAGAGLASIGKEKNIFPIQEGDQHFKH
MLRHLAIAHCDAADPISRYAREELGKPSVRQADQVVVTGQLTEDMLHLAEIGGGRVTVIL
AKEKDAELSQAENVMIERMMKRQIRVRIMRGGRVSRVV
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaataagaaatggcaatggctcgtatatggttggaagctgattatattaactttattg
acggctgctgttttttcttatgcgatgtttcagggcggctttgtcagctggtttttgttt
tacgcgtttctcccttttgtcttgtatgccgggctgttggccttgtatccgctccgttct
tttcaggcttcaaggcaaatggataaaacacaattgcatgcgggggacaggctgggcgta
acggttacgctgagaagaaagctgccatttccgctgatgtatatggtgattgaagattgc
ctgccagaaggtatcgagtcattaaatcgagacggagccgcggccaaacggctcgttttt
ccttggtttaaacggagcatgacgatgtcgtatgaattagctcgggtaccgcgcggagag
catcactttcattctgtcagggtgcgaaccggggatgttcttggcttgattgaaaaaaca
gcattttttgagctggatgataccttgtttgtttatccattctatcagcgtttttcctat
caggtgaatgagaggcatcaggaagacggtgtaagcggttcttctcctattcatcagcac
cattcctcagtcgcagcaagtgtgcggaattatcagccgggagaccggtttgctgcgtta
gattggaagacatctgcacggcggagccagctgatgacgaaggaatttgagccttctcgc
agcaaaaatctgtttctgctgatggaccgtttttcctcagacgcattcgaagaggtcgtt
tcagtgacagcttcgattcttcattctgttttaaaaaacggcgcgggtgctggtctggct
tccatcgggaaggaaaaaaacattttccctattcaggaaggggatcagcattttaagcac
atgcttcggcatttagccatcgctcattgtgatgcggcagacccgataagccgatatgca
cgggaagagctgggaaagccatctgttcgccaagctgatcaagttgttgtcacgggacag
ttaacggaagatatgctgcacctcgcagaaataggaggcggccgggttacggtgatactg
gcaaaagagaaagatgctgagctctctcaagctgaaaatgtcatgattgaacgcatgatg
aaacgccaaatcagagttcggatcatgaggggcgggcgagtttcgcgtgttgtttag

DBGET integrated database retrieval system