KEGG   Bacillus subtilis subsp. subtilis 168: BSU06360
Entry
BSU06360          CDS       T00010                                 

Symbol
guaA
Name
(RefSeq) GMP synthase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06360 (guaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU06360 (guaA)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     BSU06360 (guaA)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   BSU06360 (guaA)
SSDB
Motif
Pfam: GATase GMP_synt_C NAD_synthase Peptidase_C26 tRNA_Me_trans QueC Asn_synthase ATP_bind_3 ThiI GATase_3 Arginosuc_synth PAPS_reduct
Other DBs
NCBI-GeneID: 936028
NCBI-ProteinID: NP_388517
Pasteur: BG10647
BSORF: BG10647
UniProt: P29727 A0A6M4JFL8
Position
692740..694281
AA seq 513 aa
MTKLVNEMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKKMNPKGIILSGGPN
SVYDENSFRCDEKIFELDIPVLGICYGMQLMTHYLGGKVEAASQREYGKANIRIEGTPDL
FRDLPNEQVVWMSHGDLVVEVPEGFTVDATSHHCPNSAMSKADKKWYGVQFHPEVRHSEY
GNDLLKNFVFGVCECEGEWSMENFIEIEMQKIRETVGDKQVLCALSGGVDSSVVAVLIHK
AIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFNMNVIKVDAKDRFLNKLKGVSDPEQKRK
IIGNEFIYVFDDEADKLKGIDYLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFEL
IEPLNTLFKDEVRALGTELGIPDEIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDAILR
EEIANHGLERDIWQYFTVLPDIRSVGVMGDARTYDYTIGIRAVTSIDGMTSDWARIPWDV
LEVISTRIVNEVKHINRVVYDITSKPPATIEWE
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgacaaagttagtgaatgaaatgattcttgtccttgatttcggcagtcagtataaccag
ctgattacacgccgtatccgtgaattcggtgtttacagcgagctgcatccacatacattg
acggctgaagaaattaaaaaaatgaatccaaaaggaattattttatccggcggtccaaac
agtgtgtatgatgaaaactctttccgctgtgacgagaaaatcttcgagcttgatattcct
gttttgggaatttgctacggcatgcagctgatgactcattaccttggcggtaaagttgaa
gcggcaagccagcgtgaatacggaaaagcaaacatccgcatcgaaggcacacctgatttg
ttcagagatcttccgaatgaacaagtggtttggatgagccacggcgatttggttgtagaa
gttcctgaaggcttcactgttgacgcgacaagccatcactgcccgaactcagcaatgagc
aaagcggacaaaaaatggtatggcgttcagttccacccggaagtgcgccactctgaatac
ggcaatgatcttctgaaaaactttgtattcggtgtttgcgaatgcgaaggcgaatggtca
atggagaactttatcgaaatcgaaatgcaaaaaatccgtgaaacggtcggagacaaacag
gttctttgcgcgctaagcggcggcgttgattcctctgttgttgctgttttgattcataaa
gcgatcggcgaccagctgacttgtatctttgtagaccatggtcttctccgtaaaggcgaa
gctgagggtgttatgaaaacattcagcgaaggctttaacatgaatgtgattaaagtagac
gcaaaagatcgattcttaaacaaactaaaaggcgtttctgatcctgagcaaaaacgcaaa
atcatcggtaatgaattcatttacgtgtttgatgatgaagcggacaagctcaaaggcatc
gactaccttgcacaaggtacgctttacacagatatcatcgagagcggtacagcaacggcg
caaacgatcaaatctcaccacaatgtcggcggacttcctgaagacatgcagtttgagctg
atcgagccgttaaatacgctcttcaaagacgaagtgcgcgcgcttggcacagagctcggc
attccggatgaaatcgtatggcgtcagccgttcccaggaccgggactcggaatccgcgtt
cttggcgaagtaacagaagaaaaacttgaaatcgttcgtgaatcagatgcaatcttgcgt
gaagaaattgcaaatcacggcttagagcgtgatatctggcaatacttcactgttcttcct
gacatccgcagcgttggtgttatgggtgacgcaagaacatatgattacacaatcggaatc
cgcgccgttacatcaatcgacggcatgacatctgactgggcgcgtatcccgtgggatgtg
cttgaagtcatttcgacacgtatcgtaaacgaagtgaagcacattaaccgcgtggtgtat
gatattacaagtaagccgcctgcgacgattgagtgggaataa

DBGET integrated database retrieval system