KEGG   Bacillus subtilis subsp. subtilis 168: BSU06370
Entry
BSU06370          CDS       T00010                                 

Symbol
pbuG
Name
(RefSeq) guanine/hypoxanthine permease PbuG
  KO
K06901  adenine/guanine/hypoxanthine permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU06370 (pbuG)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU06370 (pbuG)
SSDB
Motif
Pfam: Xan_ur_permease
Other DBs
NCBI-GeneID: 936043
NCBI-ProteinID: NP_388518
Pasteur: BG12811
BSORF: BG12811
UniProt: O34987 A0A6M4JG57
Position
694662..695984
AA seq 440 aa
MKTFFQFDELGTSYRNEIIGGLTTFLSMAYILFVNPITLALESVKDFPEALRIDQGAVFT
ATALASAAGCILMGLIARYPIAIAPGMGLNAFFAFSVVLGMGISWQAALSGVFISGLIFV
ALSLTGFREKIINAIPPELKLAVGAGIGLFITFVGLQGSGIITANPSTLVTIGNIHSGPV
LLTIFGVIVTVILMVLRVNAGVFIGMLLTAVAGMIFGLVPVPTQIIGSVPSLAPTFGQAW
IHLPDIFSVQMLIVILTFLFVGFFDTAGTLVAVATQAGLMKENKLPRAGRALLADSSSIV
IGAVLGTSTTTSYVESSSGVAAGARSGFAAIVTGILFLLATFFSPLLSVVTSNVTAPALI
IVGALMVAPLGKIAWDKFEVAVPAFLTMIMMPLTYSIATGIAIGFIFYPITMVCKGKAKE
VHPIMYGLFVVFILYFIFLK
NT seq 1323 nt   +upstreamnt  +downstreamnt
ttgaaaacgttttttcagtttgatgagctgggcaccagctatcgcaatgaaatcattggc
ggattaacgacttttttatctatggcatatattttgttcgtcaatccgattacgcttgct
ttggagagcgtgaaagattttccggaggcgctgagaattgaccagggtgcggtctttacg
gcgacagcgctggcgtctgcagcaggctgtatcttaatgggattaatagcgagatatccg
attgccatcgcgccgggtatggggctgaacgcgttttttgcgttttctgttgtccttggt
atgggtatttcatggcaggcagctttgtccggtgtttttatttcaggtcttattttcgtt
gctctttctttaacaggttttcgtgaaaaaatcatcaacgccattccgcctgagctgaaa
ttggcagtcggtgcggggatcggcctgtttattacatttgttggattacaaggttcagga
atcattacagcgaatccttctacgctcgtcacgatcggaaacattcacagcggtcctgtg
ctgttaacgattttcggtgtgattgtcacggttattttaatggtgcttcgcgtgaacgca
ggcgtgtttatcgggatgctattaacagcggtagccggcatgattttcggtttggttccg
gttccgactcaaattatcggcagtgtgccaagccttgcgccgactttcggacaagcgtgg
attcacctcccggatattttctctgtacaaatgctgatcgttattttaacattcttgttt
gtcggattttttgatacagctggtacacttgttgctgtggcaacacaagctggtttaatg
aaggaaaacaaattgccgcgtgcgggccgtgcgcttttagctgattcatcttctattgtg
atcggtgccgtgcttggtacgtctacaacaacttcttacgtggaatcaagctcaggtgtc
gctgcgggtgcccggtcaggatttgccgcaattgtaacagggattctctttttactggct
acgtttttctcgccgctcctatcagtcgttacgtcaaatgtaacagcgccggcgcttatt
attgttggtgcattgatggtggcgccgcttggcaaaatcgcttgggataagttcgaagtg
gccgttcctgctttccttaccatgatcatgatgccgttaacgtacagcatcgcgactggt
attgccatcggatttattttctatccgattacaatggtgtgcaaaggaaaagcaaaagag
gttcatccaatcatgtacgggctgtttgtcgtatttatcctgtactttatcttcttaaaa
taa

DBGET integrated database retrieval system