KEGG   Bacillus subtilis subsp. subtilis 168: BSU06380
Entry
BSU06380          CDS       T00010                                 

Symbol
yebC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PIG-Y RR_TM4-6 Yip1
Other DBs
NCBI-GeneID: 939478
NCBI-ProteinID: NP_388519
Pasteur: BG12812
BSORF: BG12812
UniProt: O34341 A0A6M3Z8J0
Position
696195..696998
AA seq 267 aa
MTEERKETFEEEINQSERIDADEEPLSRMSRKASRQSKQKQKQKQKPRQERGESTVKDKL
ASVWAAINRYCGFAFSILKSPAKTVVTDGFSHYKYGLISMLIFSIIFSIGNWFQLKASWN
RPLGFGERHHAFYDGFLVVLVYLLIFFAVMVFAIWAVSRYMMKQKVTFREAAAVLGSLLV
PVIAVSILWLIFAIVNIPMLTVLFTVLILFSIFFIIALYVQRVYQAAQDAPIDYIYCVFA
VVAIALLFTAVTWPFISEYITASLIPL
NT seq 804 nt   +upstreamnt  +downstreamnt
atgacggaagaaagaaaagaaacgtttgaagaagaaattaaccagagtgaaagaatagat
gcagatgaagaaccgctatcgagaatgtccagaaaggcgagccggcaaagcaagcagaag
caaaaacaaaagcagaaaccgcgccaggaacgcggtgaatcaactgttaaagacaagctt
gcgtctgtttgggcagccatcaacagatattgcggttttgcgttctcgattttaaaatct
ccggcgaaaactgtcgtaacggatggtttttctcattataagtacggtctgatttcaatg
cttatattcagtatcattttttcaattgggaattggtttcagttaaaggcaagctggaat
cggccgctcggtttcggagaacgccatcatgctttctatgacgggtttttagttgttctt
gtgtatttgctgatctttttcgcggtaatggtctttgctatatgggctgtctcccgctat
atgatgaagcagaaggtgacgttcagagaagcggctgccgtattgggttcattgcttgta
cccgtaattgctgtttcaatcctttggctgatctttgcgatcgtaaatatcccaatgctg
acagtactgtttacggtgctgatcttgttttccatcttttttatcatcgcgctgtatgta
cagcgtgtgtaccaggcggcacaagatgcaccaattgattatatctattgtgtatttgca
gtagttgcgatagcgctgctgtttacggcagtgacttggccgtttatttctgaatatatt
acggcgtcgttgattccgctttaa

DBGET integrated database retrieval system