KEGG   Bacillus subtilis subsp. subtilis 168: BSU06390
Entry
BSU06390          CDS       T00010                                 

Symbol
yebD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Fur_reg_FbpA WD40_alt
Other DBs
NCBI-GeneID: 936033
NCBI-ProteinID: NP_388520
Pasteur: BG12813
BSORF: BG12813
UniProt: O34904 A0A6M4JFR1
Position
697157..697324
AA seq 55 aa
MADVLRRAINQKKQFLKTKLLLSEFYQGRGEQLADYTLSELEKEYKSLQKMKKEI
NT seq 168 nt   +upstreamnt  +downstreamnt
atggctgatgtacttcgccgagcaattaaccaaaagaagcaatttttaaaaaccaaatta
ctgctctcggaattttatcaaggaagaggggaacagcttgctgactacacgctgagtgag
cttgagaaagaatacaagtcccttcagaaaatgaaaaaagagatctga

DBGET integrated database retrieval system