KEGG   Bacillus subtilis subsp. subtilis 168: BSU06400
Entry
BSU06400          CDS       T00010                                 

Symbol
yebE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5698 DUF2179
Other DBs
NCBI-GeneID: 939480
NCBI-ProteinID: NP_388521
Pasteur: BG12814
BSORF: BG12814
UniProt: O34624 A0A6M4JH09
Position
697538..698092
AA seq 184 aa
MMQTILSNGIAMVLIILIINIVYVSFFTIRMILTLKGQRYLAAGISTIEILVYVTGLSLV
LDNLDQIQNVIAYALGYGLGVIVGMKIEEKLALGYIMVNVITKELDLDLPKQLREKGYGV
TNWVAGGLEGDRTALQILTPRRYELQLYDTIKTLDSKAFIIAYEPKTIHGGFWVKAVKKR
RIKE
NT seq 555 nt   +upstreamnt  +downstreamnt
atgatgcaaaccatcttatcaaatgggatagccatggttctcataattctcattattaat
attgtctatgtgtcattttttacgataagaatgattttaacgctgaaaggacagcgttat
ttagcggccggcatcagtacgattgaaatactggtttatgtgacaggactgagtctggtg
ctcgataacttagaccagattcaaaatgtgatcgcgtacgcgctcggttacggtcttggc
gtaattgtcggcatgaaaatagaagaaaaattggcgcttggctatattatggtcaatgtg
attacgaaggagctcgatcttgatcttccgaagcagctccgtgaaaaaggctacggcgtg
acaaactgggtggcaggcgggcttgaaggcgaccgcacagcccttcagatcctgacgccg
agaagatatgaactccagctatatgatacgattaaaacacttgattcaaaagcctttatt
attgcgtacgaaccaaaaacaatccacggcggcttctgggtcaaagcggtgaagaagagg
agaattaaagaataa

DBGET integrated database retrieval system